Align D-galactarolactone cycloisomerase (EC 5.5.1.27) (characterized)
to candidate WP_013721158.1 ALIDE2_RS00485 mandelate racemase/muconate lactonizing enzyme family protein
Query= BRENDA::A9CEQ8 (378 letters) >NCBI__GCF_000204645.1:WP_013721158.1 Length = 387 Score = 127 bits (320), Expect = 4e-34 Identities = 105/354 (29%), Positives = 157/354 (44%), Gaps = 21/354 (5%) Query: 32 VLVEIECDDGTVGWGEC--LGPARPNAAVVQAYSGWLIGQDPRQTEKIWAVLYNALRDQG 89 + V I DDGTVG+GE G ++ ++ +L G+D E W V++ G Sbjct: 15 MFVRITTDDGTVGYGEAGTWGHIEAAGVCIRRFAEYLEGKDAFAIEHHWNVMHRFSYFTG 74 Query: 90 QRGLSLTALSGIDIALWDIKGKHYGASISMLLGGRWRESVRAYATGSFKRDNVDRVSDNA 149 A+S IDIALWDIKGK I LLGG R R Y G ++++++ Sbjct: 75 LA--ENAAISAIDIALWDIKGKALNVPIYELLGGAARTKARIY--GHIYENSIEKMLVEC 130 Query: 150 SEMAERRAEGFHACKIKIGFG------------VEEDLRVIAAVREAIGPDMRLMIDANH 197 E F + G + + + +RE +G + L+I+ + Sbjct: 131 QAKMEAGFNAFGHLNPFLDEGNDQVYFKTHIKKMRDAIDNTRRMREVVGDRVDLLIEIHR 190 Query: 198 GYTVTEAITLGDRAAGFGIDWFEEPVVPEQLDAYARVRAGQPIPVAGGETWHGRYGMWQA 257 T EAI + E+P+ PE D ARV IP+A GE + Y Sbjct: 191 RLTPAEAIVFARGIEDTHPMFIEDPIRPEGPDGMARVAEKIGIPIATGERFANLYEFQTL 250 Query: 258 LSAGAVDILQPDLCGCGGFSEIQKIATLATLHGVRIVPHVWGTGVQIAAALQFMAAMTPD 317 ++ G V+ + DLC CGG + +K+A LA H V++VPH + + +AA LQ AA+ Sbjct: 251 MARGGVEYARVDLCLCGGITGAKKVAALAEAHHVQVVPHNPLSPIGLAACLQLDAAIPNF 310 Query: 318 PVR--VNPIEPIMEFDRTHNPFRQAVLREPLEAVNGVVTIPDGPGLGIEINRDA 369 ++ E + R + V + PL G V IP GPGLG+ + DA Sbjct: 311 AIQEYATGFEAGIFESRPEHLGSDIVDQVPLPDA-GFVDIPTGPGLGMNLLPDA 363 Lambda K H 0.321 0.138 0.431 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 418 Number of extensions: 27 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 378 Length of database: 387 Length adjustment: 30 Effective length of query: 348 Effective length of database: 357 Effective search space: 124236 Effective search space used: 124236 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory