Align Sugar ABC transporter ATP-binding protein (characterized, see rationale)
to candidate WP_013723230.1 ALIDE2_RS22605 putative 2-aminoethylphosphonate ABC transporter ATP-binding protein
Query= uniprot:A0A165KQ08 (355 letters) >NCBI__GCF_000204645.1:WP_013723230.1 Length = 377 Score = 244 bits (624), Expect = 2e-69 Identities = 136/290 (46%), Positives = 187/290 (64%), Gaps = 10/290 (3%) Query: 2 ASSLDIAGINKRFGKGDKSVEVLRKVDIHVAPGEFLILVGPSGCGKSTLLNIIAGLDEPT 61 A +L+I GI+K F ++ LR +D+ V GE L +GPSGCGK+TLL IIAGL+ T Sbjct: 17 APALEIKGIHKNF----ENFSALRDIDLTVRQGEMLCFLGPSGCGKTTLLRIIAGLETQT 72 Query: 62 EGEIRIGGKNVVGMPPRDRDIAMVFQSYALYPTLSVADNIGFALEMRKMPKPERQKRIDE 121 G I G+++ +P +RD +VFQSYAL+P L++A+N+ + L KM K E Q R+ E Sbjct: 73 SGSIVQSGRDISWLPASERDYGIVFQSYALFPNLTIAENVAYGLVNGKMRKAEIQARVAE 132 Query: 122 VAAMLQISHLLDRRPSQLSGGQRQRVAMGRALARQPQLFLFDEPLSNLDAKLRVEMRAEI 181 + AM + + PSQLSGGQ+QRVA+ RALA P L L DEPLS LDA +RV +RAEI Sbjct: 133 LLAMAGLPTAGGKYPSQLSGGQQQRVALARALATNPGLLLLDEPLSALDATVRVRLRAEI 192 Query: 182 KRLHQASGITSVYVTHDQVEAMTLGSRIAVMKGGVVQQLGTPDEIYNRPANTYVATFIGS 241 +RL + GIT++ VTHDQ EA+++ RI VM GV++Q+GTP EIY RPA+ +VA F+G Sbjct: 193 RRLQKQVGITTIMVTHDQEEALSMSDRIVVMNHGVIEQVGTPMEIYERPASPFVANFVGK 252 Query: 242 PTMNLLRGAVTGG-QFGIQGAALNLAPPPSS---ANEVLLGVRPEHLVMQ 287 +N+LRG GG +F + + S +V L +RPE V + Sbjct: 253 --VNVLRGQALGGKRFRVGKMEIECEASEGSFRLGEDVSLYLRPEDRVAE 300 Lambda K H 0.318 0.135 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 311 Number of extensions: 15 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 355 Length of database: 377 Length adjustment: 30 Effective length of query: 325 Effective length of database: 347 Effective search space: 112775 Effective search space used: 112775 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory