Align Maltose-transporting ATPase (EC 3.6.3.19) (characterized)
to candidate WP_013517832.1 ALIDE2_RS04530 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= reanno::psRCH2:GFF857 (371 letters) >NCBI__GCF_000204645.1:WP_013517832.1 Length = 335 Score = 313 bits (802), Expect = 4e-90 Identities = 174/357 (48%), Positives = 228/357 (63%), Gaps = 34/357 (9%) Query: 1 MASVTLRDICKSY----DGTPITRHIDLDIEDGEFVVFVGPSGCGKSTLLRLIAGLEDIT 56 MAS++L++I K Y P+ ++ +I+DGEF+V VGPSGCGKSTLLR+IAGLE+IT Sbjct: 1 MASISLKNIVKRYGSGKSAVPVIHGVNAEIKDGEFIVLVGPSGCGKSTLLRMIAGLEEIT 60 Query: 57 SGDLLIDNQRVNDLPPKDRSVGMVFQSYALYPHMTVAENMAFGLKLASVDKREIKRRVEA 116 G+L I ++ VN L P R++ MVFQ+YALYPHMT ENMA+GLKLA V K EI+RRV+ Sbjct: 61 GGELFIGDRLVNGLEPARRNIAMVFQNYALYPHMTNFENMAYGLKLAKVPKDEIRRRVDK 120 Query: 117 VAEILQLDKLLERKPKDLSGGQRQRVAIGRTMVREPKVFLFDEPLSNLDAFLRVQMRIEI 176 A+IL+L LLERKP++LSGGQRQRVA+GR +VREP+VFLFDEPLSNLDA LR Q RIEI Sbjct: 121 AAKILELSHLLERKPRELSGGQRQRVAMGRAIVREPQVFLFDEPLSNLDAKLRGQTRIEI 180 Query: 177 ARLHQRIRSTMIYVTHDQVEAMTLADKIVVLNAGEIAQVGQPLHLYHYPKNRFVAGFLGS 236 +LH + T ++VTHDQVEAMTLA +++V+NAG + Q G P +YH P FVA F+GS Sbjct: 181 QKLHTELGITSLFVTHDQVEAMTLAQRMIVMNAGNVEQFGTPEEVYHEPATTFVASFIGS 240 Query: 237 PQMNFVEVRAISASPETVTIELPSGYPLTLPVDGSAVSPGDPLTLGIRPEHFVMPDEADF 296 P MN ++ + P G P + LGIRPEH + + + Sbjct: 241 PPMNLLK-------------QAPGGQPGRI--------------LGIRPEHIDLVESGGW 273 Query: 297 TFHGQITVAERLGQYNLLYLTLERLQDVITLCVDGNLRVTEGETFAAGLKADKCHLF 353 F ++ E LG LLY + +D+ + GET + D+ H F Sbjct: 274 EF--KVETLELLGAERLLYGKVGD-EDLTVRTEEDKPYPKPGETTRIAPRRDRVHWF 327 Lambda K H 0.322 0.139 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 369 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 371 Length of database: 335 Length adjustment: 29 Effective length of query: 342 Effective length of database: 306 Effective search space: 104652 Effective search space used: 104652 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory