Align 5-aminovalerate transaminase (EC 2.6.1.48) (characterized)
to candidate WP_013721656.1 ALIDE2_RS06730 aspartate aminotransferase family protein
Query= BRENDA::Q9I6M4 (426 letters) >NCBI__GCF_000204645.1:WP_013721656.1 Length = 442 Score = 184 bits (468), Expect = 4e-51 Identities = 131/421 (31%), Positives = 213/421 (50%), Gaps = 18/421 (4%) Query: 21 GQIHPVVAERAENSTVWDVEGREYIDFAGGIAVLNTGHLHPKVIAAVQEQLGKLSHTCFQ 80 G P + A+ V D GRE +DF G GH HP ++ AVQE G+ ++ F Sbjct: 18 GDTFPSLFRSAKGCVVTDDTGREILDFTSGQMCATIGHNHPAIVQAVQEA-GEKAYHMFS 76 Query: 81 VLAYEPYIELAEEIAKRVPGDFPKKTLLVTSGSEAVENAVKIARAATGRAGVIAFTGAYH 140 + E LA+ +A+ K++ + +GSE+ E A+++A+ T ++A G++H Sbjct: 77 GMIPEVVARLAQTMARDWMPQGLSKSIFINTGSESNEVALRMAKMYTQGFEILAVGGSWH 136 Query: 141 GRTMMTLGLTGKVVPYSAGMGLMPGGIFRALAPCE----LHGVS-EDDSIASIERIFK-- 193 G T G G+ G+F P + G+ E ++A +E K Sbjct: 137 GVT--GAASAASFASDRKGYGVHVPGVFVMPEPNMYRPYIQGMDGEASALACLEIGLKMY 194 Query: 194 NDAQPQDIAAIIIEPVQGEGGFYVNSKSFMQRLRALCDQHGILLIADEVQTGAGRTGTFF 253 + A +AIIIEP+ GG V KS+MQ LR D+ G+LLI DE QT GR G Sbjct: 195 DMASTGRRSAIIIEPIISAGGVLVPPKSYMQALRKAADERGMLLIFDEAQTAFGRIGHRH 254 Query: 254 ATEQLGIVPDLTTFAKSVGGGFPISGVAGKAEIMDAIAPGGLG--GTYAGSPIACAAALA 311 A + G+ PD+ +K++GGG P++ V+ EI + I G ++ P+ LA Sbjct: 255 AADFFGVTPDIMAVSKTMGGGLPLAAVSTTPEIEEDIHAKGFTFYTSHVSDPLPATVGLA 314 Query: 312 VLKVFEEEKLLERSQAVGERLKAGLREIQAKHKVIGDVRGLGSMVAIELFEGGDTHKPAA 371 VL+ ++E+L+ER+Q++G L+ L E+Q++++ IGDVRG G ++ +EL + +T +P Sbjct: 315 VLRTIQQERLIERAQSMGAYLRRRLEELQSRYEAIGDVRGEGMLLGVELVKSRETREPYH 374 Query: 372 ELVSKIVVRAREKGLI--LLSCGTYYNVIRFLMPVTIPDAQLEKGLAILAEC----FDEL 425 L + R E GL + +V R P+T ++++G+ +L E DE+ Sbjct: 375 ALGAITTQRCYELGLSMNIRRRPERGSVWRIAPPLTATQGEIDRGVDMLDEALRRSIDEI 434 Query: 426 A 426 A Sbjct: 435 A 435 Lambda K H 0.319 0.137 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 423 Number of extensions: 18 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 426 Length of database: 442 Length adjustment: 32 Effective length of query: 394 Effective length of database: 410 Effective search space: 161540 Effective search space used: 161540 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory