Align HutV aka HISV aka R02702 aka SMC00670, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized)
to candidate WP_013518027.1 ALIDE2_RS18590 glycine betaine/L-proline ABC transporter ATP-binding protein ProV
Query= TCDB::Q9KKE1 (275 letters) >NCBI__GCF_000204645.1:WP_013518027.1 Length = 434 Score = 300 bits (769), Expect = 3e-86 Identities = 151/262 (57%), Positives = 200/262 (76%) Query: 4 IEIRNVYKIFGHDAKKALTMVEDGLDKADILSRSGCTVGLNDVSLKIGAGKIFVIMGLSG 63 I I +V+K+FG ++AL +V+ GL K +IL R+G ++G+ D S I G+IFV+MGLSG Sbjct: 5 IIIDHVFKVFGDAPQEALRLVQQGLSKQEILERTGHSIGVFDASFTIETGEIFVVMGLSG 64 Query: 64 SGKSTLVRHINRLIEPTSGEVLFDGDNILDLGAKALRAFRMRRVSMVFQSFALMPHRTVL 123 SGKSTLVR +NRLI PTSG +L DG +I +L + LRA R + +SMVFQSFALMPH TVL Sbjct: 65 SGKSTLVRMLNRLIAPTSGRILVDGQDINELSQRQLRALRRKDISMVFQSFALMPHMTVL 124 Query: 124 QNVVYGQRVRGVSKDDAREIGMKWIDTVGLSGYDAKFPHQLSGGMKQRVGLARALAADTD 183 N +G + G+ K ++ + ++ VGL+G+ A +P +LSGGM+QRVGLARALAAD Sbjct: 125 DNTAFGLELAGMDKAGRQQAAQEALEQVGLAGWGASYPDELSGGMQQRVGLARALAADPS 184 Query: 184 VILMDEAFSALDPLIRGDMQDQLLQLQRNLAKTIVFITHDLDEALRIGSEIAILRDGQVV 243 ++LMDEAFSALDP+IR +MQ +LL+LQ+ +TIVFI+HDLDEA+RIG IAI++DG VV Sbjct: 185 ILLMDEAFSALDPIIRTEMQSELLRLQQVKRRTIVFISHDLDEAMRIGDRIAIMKDGHVV 244 Query: 244 QVGTPNDILDNPANDYVARFVQ 265 QVGTP++IL PANDYV FV+ Sbjct: 245 QVGTPDEILREPANDYVRDFVR 266 Lambda K H 0.323 0.139 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 369 Number of extensions: 7 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 275 Length of database: 434 Length adjustment: 29 Effective length of query: 246 Effective length of database: 405 Effective search space: 99630 Effective search space used: 99630 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory