Align ABC transporter for Xylitol, ATPase component (characterized)
to candidate WP_013723230.1 ALIDE2_RS22605 putative 2-aminoethylphosphonate ABC transporter ATP-binding protein
Query= reanno::Dino:3607124 (338 letters) >NCBI__GCF_000204645.1:WP_013723230.1 Length = 377 Score = 226 bits (577), Expect = 5e-64 Identities = 141/344 (40%), Positives = 202/344 (58%), Gaps = 33/344 (9%) Query: 4 IKIDKINKFYGTTQALFDINLDIEDGEFVVFVGPSGCGKSTLLRTLAGLEGVSSGRIEIG 63 ++I I+K + AL DI+L + GE + F+GPSGCGK+TLLR +AGLE +SG I Sbjct: 20 LEIKGIHKNFENFSALRDIDLTVRQGEMLCFLGPSGCGKTTLLRIIAGLETQTSGSIVQS 79 Query: 64 GRDVTTVEPADRDLAMVFQSYALYPHMTVRENMEFGMKVNGFEPDLRKE----RIAEAAR 119 GRD++ + ++RD +VFQSYAL+P++T+ EN+ +G+ VNG +RK R+AE Sbjct: 80 GRDISWLPASERDYGIVFQSYALFPNLTIAENVAYGL-VNG---KMRKAEIQARVAELLA 135 Query: 120 VLQLEDYLDRKPGQLSGGQRQRVAIGRAIVKNPSVFLFDEPLSNLDAKLRVQMRVELEGL 179 + L + P QLSGGQ+QRVA+ RA+ NP + L DEPLS LDA +RV++R E+ L Sbjct: 136 MAGLPTAGGKYPSQLSGGQQQRVALARALATNPGLLLLDEPLSALDATVRVRLRAEIRRL 195 Query: 180 HKQLGATMIYVTHDQVEAMTMADKIVVLNRGRIEQVGSPMDLYHKPNSRFVAEFIGSPAM 239 KQ+G T I VTHDQ EA++M+D+IVV+N G IEQVG+PM++Y +P S FVA F+G + Sbjct: 196 QKQVGITTIMVTHDQEEALSMSDRIVVMNHGVIEQVGTPMEIYERPASPFVANFVGK--V 253 Query: 240 NVFSSD--------VGLQDISLDASAAFVGCRPEHIEIVPDGDGHIAATVHVKERLGGES 291 NV VG +I +AS + D ++ V E L + Sbjct: 254 NVLRGQALGGKRFRVGKMEIECEASEG-------SFRLGEDVSLYLRPEDRVAEHLEAGT 306 Query: 292 LLYLGLKG------GGQIVARVGGDDETKVGAAVSLRFSRHRLH 329 LG+ GG +A V E G ++ L FS +++H Sbjct: 307 PYRLGVLVNKVEFLGGLCIAEVSA--EALGGQSLGLHFSLNQMH 348 Lambda K H 0.320 0.139 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 352 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 338 Length of database: 377 Length adjustment: 29 Effective length of query: 309 Effective length of database: 348 Effective search space: 107532 Effective search space used: 107532 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory