Align Putative 2-dehydro-3-deoxy-D-gluconate aldolase YagE; KDG aldolase YagE; Putative 2-dehydro-3-deoxy-D-pentonate aldolase YagE; EC 4.1.2.51; EC 4.1.2.28 (characterized)
to candidate WP_013520068.1 ALIDE2_RS05900 4-hydroxy-tetrahydrodipicolinate synthase
Query= SwissProt::P75682 (302 letters) >NCBI__GCF_000204645.1:WP_013520068.1 Length = 300 Score = 109 bits (273), Expect = 7e-29 Identities = 77/247 (31%), Positives = 124/247 (50%), Gaps = 7/247 (2%) Query: 4 SALFTGIIPPVSTIFTADGQLDKPGTAALIDDLIKAGVDGLFFLGSGGEFSQLGAEERKA 63 SA F+G+ P+ T F DG +D AL+ L G+ G+ GS GE + L E+ A Sbjct: 7 SAGFSGLWIPLVTPFDGDGAIDHAALRALVQRLRSGGIAGVVACGSTGEAAALDTAEQDA 66 Query: 64 IARFAIDHVDRRVPVLIGTGGTNARETIELSQHAQQAGADGIVVINPYYWKVSEANLIRY 123 A A+ +PV++G G + +E + G++V P+Y + S+A L+++ Sbjct: 67 -ALDAVLAAAPGLPVVMGLSGYHLGHVLERVRGWNTRPLAGLLVPAPHYIRPSQAGLLQW 125 Query: 124 FEQVADSVTLPVMLYNFPALTGQDLTPALVKTLADSRSNIIGIKDTIDSVAHLRSMIHTV 183 F +AD+ P+++Y+ P TG L A ++ LA+ I IKD A +++I Sbjct: 126 FRTIADASMHPLIIYDIPYRTGATLELATLQALAE-HPRIRAIKDCGGDAAKTQALI--- 181 Query: 184 KGAHPHFTVLCGYDDHLFNTLLLGGDGAISASGNFAPQVSVNLLKAWRDGDVAKAAGYHQ 243 + VL G D + +TL LGG GAI+AS ++ P L++ GD+ +A Q Sbjct: 182 --SGGRLQVLAGEDAQILSTLALGGSGAIAASAHWQPARFAELMRCVATGDLPRARALWQ 239 Query: 244 TLLQIPQ 250 LL + Q Sbjct: 240 ALLPVVQ 246 Lambda K H 0.320 0.138 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 209 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 302 Length of database: 300 Length adjustment: 27 Effective length of query: 275 Effective length of database: 273 Effective search space: 75075 Effective search space used: 75075 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory