Align NAD(P)-dependent dehydrogenase (Short-subunit alcohol dehydrogenase family) (characterized, see rationale)
to candidate WP_013721926.1 ALIDE2_RS09190 3-oxoacyl-ACP reductase FabG
Query= uniprot:A0A4R8NY47 (263 letters) >NCBI__GCF_000204645.1:WP_013721926.1 Length = 252 Score = 131 bits (329), Expect = 2e-35 Identities = 81/245 (33%), Positives = 127/245 (51%), Gaps = 1/245 (0%) Query: 15 RSLAGKRVVITGGGSGIGAALVEAFVGQGAQVCFLDIATEPSEALVASLKDAAVAPRFFP 74 ++L + +TG G GIGAA+ EA+ QGA+V +D+ +E + A +++ + F Sbjct: 5 QALQDRVAFVTGAGQGIGAAVAEAYGAQGAKVAVVDLRLATAEKVAAGIRERGGQAQAFA 64 Query: 75 CNLMNLEALRATFTEIETVMGGVDILINNAANDDRHKSEDVTPAYWDERLAVNLRHQFFC 134 C++ + + + A ++ G V+IL+NNA +T WDE +AV+L F C Sbjct: 65 CDVSDRQQVDAAVKQVNEAFGPVEILVNNAGITHTAMLHRMTTPQWDEVIAVHLTGSFNC 124 Query: 135 AQAVLPGMRERKGGVILNFGSISWHLGLPDLTLYMTAKAGIEGMTHGMARDFGRDGVRVN 194 QAV+ GM ERK G I+N S + LG Y +AKAG+ G T A++ R + VN Sbjct: 125 LQAVVNGMMERKQGWIINVTSTAGILGTLGQINYGSAKAGLLGFTKSAAKELARYNIVVN 184 Query: 195 AIIPGAIRTPRQTLLWHTPEEEAKILAAQCLPVRVDPHDVAALALFLSSDSGAKCTGREY 254 A+ PGA TP + P + L L +P ++A + +FL+S + TG+ Sbjct: 185 AVAPGA-ATPMTETIRTDPRFKDAYLERVPLGRWAEPAELAPVFVFLASPGASYVTGQLI 243 Query: 255 YVDAG 259 VD G Sbjct: 244 GVDGG 248 Lambda K H 0.322 0.137 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 178 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 252 Length adjustment: 24 Effective length of query: 239 Effective length of database: 228 Effective search space: 54492 Effective search space used: 54492 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory