Align BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized)
to candidate WP_013836193.1 THICY_RS08450 ABC transporter ATP-binding protein
Query= TCDB::Q52666 (263 letters) >NCBI__GCF_000214825.1:WP_013836193.1 Length = 220 Score = 123 bits (309), Expect = 3e-33 Identities = 75/211 (35%), Positives = 116/211 (54%), Gaps = 4/211 (1%) Query: 23 IQISQMNKWYGQFHVLRDINLTVHRGERIVIAGPSGSGKSTMIRCINRLEEHQSGKIIVD 82 ++IS + Y Q +L NL + GE + I GPSG GKST++R I E G+I ++ Sbjct: 2 LKISDIQVVYNQTPILDQFNLDIEAGEIVGILGPSGCGKSTLLRAIAGFVELAKGEICLN 61 Query: 83 GIELTSDLKNIDKVRSEVGMVFQHFNLFPHLTILENLTLAPIWVRKVPKREAEETAMYYL 142 L + + + VGMVFQ +LFPHLT+ N+ + K+ K E + L Sbjct: 62 NACLCNCKCFMPPEKRGVGMVFQDNSLFPHLTVAGNIAFG---LTKLNKTERQNRVNELL 118 Query: 143 EKVKIPEQAQKYPGQLSGGQQQRVAIARSLCMKPKIMLFDEPTSALDPEMIKEVLDTMIQ 202 +++ +YP +LSGGQQQRVA+AR+L KP ++LFDEP S+LD + + + + Q Sbjct: 119 TLIRLEGMGNRYPHELSGGQQQRVALARALAPKPSLILFDEPFSSLDKALSEHLAVEIRQ 178 Query: 203 LAEEGMT-MLCVTHEMGFAQAVANRVIFMAD 232 L ++ T + VTH A+ + +R + D Sbjct: 179 LLKQQKTAAILVTHTQREAELMCDRYAGLED 209 Lambda K H 0.320 0.134 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 151 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 220 Length adjustment: 23 Effective length of query: 240 Effective length of database: 197 Effective search space: 47280 Effective search space used: 47280 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory