Align PEB1C, component of Uptake system for glutamate and aspartate (characterized)
to candidate WP_013836193.1 THICY_RS08450 ABC transporter ATP-binding protein
Query= TCDB::A3ZI83 (242 letters) >NCBI__GCF_000214825.1:WP_013836193.1 Length = 220 Score = 134 bits (337), Expect = 1e-36 Identities = 78/212 (36%), Positives = 120/212 (56%), Gaps = 4/212 (1%) Query: 1 MIELKNVNKYYGTHHVLKNINLSVKEGEKLVIIGPSGSGKSTTIRCMNGLEEVSSGEVVV 60 M+++ ++ Y +L NL ++ GE + I+GPSG GKST +R + G E++ GE+ + Sbjct: 1 MLKISDIQVVYNQTPILDQFNLDIEAGEIVGILGPSGCGKSTLLRAIAGFVELAKGEICL 60 Query: 61 NNLVL-NHKNKIEICRKYCAMVFQHFNLYPHMTVLQNLTLAPMKLQKKSKKEAEETAFKY 119 NN L N K + ++ MVFQ +L+PH+TV N+ L K +K E + + Sbjct: 61 NNACLCNCKCFMPPEKRGVGMVFQDNSLFPHLTVAGNIAFG---LTKLNKTERQNRVNEL 117 Query: 120 LKVVGLLDKANVYPATLSGGQQQRVAIARSLCTKKPYILFDEPTSALDPETIQEVLDVMK 179 L ++ L N YP LSGGQQQRVA+AR+L K ILFDEP S+LD + + ++ Sbjct: 118 LTLIRLEGMGNRYPHELSGGQQQRVALARALAPKPSLILFDEPFSSLDKALSEHLAVEIR 177 Query: 180 EISHQSNTTMVVVTHEMGFAKEVADRIIFMED 211 ++ Q T ++VTH A+ + DR +ED Sbjct: 178 QLLKQQKTAAILVTHTQREAELMCDRYAGLED 209 Lambda K H 0.317 0.133 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 113 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 242 Length of database: 220 Length adjustment: 23 Effective length of query: 219 Effective length of database: 197 Effective search space: 43143 Effective search space used: 43143 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory