Align acyl CoA carboxylase biotin carboxyl carrier protein subunit (EC 2.1.3.15; EC 6.4.1.3; EC 6.3.4.14) (characterized)
to candidate WP_005458894.1 SACCYDRAFT_RS19840 acetyl/propionyl/methylcrotonyl-CoA carboxylase subunit alpha
Query= metacyc::MONOMER-13596 (167 letters) >NCBI__GCF_000244975.1:WP_005458894.1 Length = 660 Score = 61.2 bits (147), Expect = 3e-14 Identities = 29/68 (42%), Positives = 43/68 (63%) Query: 99 GEVISPLQGRIVTIRVNEGDAVNKGQPLLSVEAMKSETIISAPIAGIVEKIIVKPGQGVK 158 G V SP+ G ++ ++V GD V G PLL VEAMK E I+AP+ G+V ++ V+ GQ V Sbjct: 586 GPVTSPMPGTVLVVKVEPGDTVKAGTPLLVVEAMKMEHTITAPVDGVVSQLDVRAGQQVA 645 Query: 159 KGDTLLII 166 + L ++ Sbjct: 646 LDEPLALV 653 Score = 27.7 bits (60), Expect = 4e-04 Identities = 21/71 (29%), Positives = 37/71 (52%), Gaps = 9/71 (12%) Query: 98 EGEVISPLQGRIVTIRVNEGDAVNKGQPLLSVEAMK-SETIISAPIAGIVEKIIVKPGQG 156 +G V +GR+V AV++ LL+ A + +++P+ G V + V+PG Sbjct: 555 DGAVWYAREGRVV--------AVSERPNLLASHAESVAAGPVTSPMPGTVLVVKVEPGDT 606 Query: 157 VKKGDTLLIIK 167 VK G LL+++ Sbjct: 607 VKAGTPLLVVE 617 Lambda K H 0.313 0.136 0.368 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 247 Number of extensions: 18 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 167 Length of database: 660 Length adjustment: 28 Effective length of query: 139 Effective length of database: 632 Effective search space: 87848 Effective search space used: 87848 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory