Protein WP_014449258.1 in Leptospirillum ferrooxidans C2-3
Annotation: NCBI__GCF_000284315.1:WP_014449258.1
Length: 242 amino acids
Source: GCF_000284315.1 in NCBI
Candidate for 43 steps in catabolism of small carbon sources
| Pathway | Step | Score | Similar to | Id. | Cov. | Bits | Other hit | Other id. | Other bits |
|---|
| L-lysine catabolism | hisP | lo | Amino-acid ABC transporter, ATP-binding protein (characterized, see rationale) | 39% | 88% | 153.7 | Uncharacterized ABC transporter ATP-binding protein Rv0986 | 49% | 207.2 |
| L-arginine catabolism | artP | lo | Probable ATP-binding component of ABC transporter, component of Amino acid transporter, PA5152-PA5155. Probably transports numerous amino acids including lysine, arginine, histidine, D-alanine and D-valine (Johnson et al. 2008). Regulated by ArgR (characterized) | 38% | 79% | 147.5 | Uncharacterized ABC transporter ATP-binding protein Rv0986 | 49% | 207.2 |
| L-histidine catabolism | hisP | lo | Probable ATP-binding component of ABC transporter, component of Amino acid transporter, PA5152-PA5155. Probably transports numerous amino acids including lysine, arginine, histidine, D-alanine and D-valine (Johnson et al. 2008). Regulated by ArgR (characterized) | 38% | 79% | 147.5 | Uncharacterized ABC transporter ATP-binding protein Rv0986 | 49% | 207.2 |
| L-asparagine catabolism | peb1C | lo | PEB1C, component of Uptake system for glutamate and aspartate (characterized) | 38% | 90% | 147.1 | Uncharacterized ABC transporter ATP-binding protein Rv0986 | 49% | 207.2 |
| L-aspartate catabolism | peb1C | lo | PEB1C, component of Uptake system for glutamate and aspartate (characterized) | 38% | 90% | 147.1 | Uncharacterized ABC transporter ATP-binding protein Rv0986 | 49% | 207.2 |
| L-glutamate catabolism | gltL | lo | PEB1C, component of Uptake system for glutamate and aspartate (characterized) | 38% | 90% | 147.1 | Uncharacterized ABC transporter ATP-binding protein Rv0986 | 49% | 207.2 |
| L-histidine catabolism | BPHYT_RS24015 | lo | ABC transporter related (characterized, see rationale) | 35% | 86% | 139.4 | Uncharacterized ABC transporter ATP-binding protein Rv0986 | 49% | 207.2 |
| L-asparagine catabolism | bgtA | lo | ATPase (characterized, see rationale) | 37% | 87% | 139 | Uncharacterized ABC transporter ATP-binding protein Rv0986 | 49% | 207.2 |
| L-aspartate catabolism | bgtA | lo | ATPase (characterized, see rationale) | 37% | 87% | 139 | Uncharacterized ABC transporter ATP-binding protein Rv0986 | 49% | 207.2 |
| D-glucosamine (chitosamine) catabolism | SM_b21216 | lo | ABC transporter for D-Glucosamine, ATPase component (characterized) | 38% | 57% | 137.1 | Uncharacterized ABC transporter ATP-binding protein Rv0986 | 49% | 207.2 |
| L-histidine catabolism | aapP | lo | ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component (characterized) | 36% | 88% | 132.5 | Uncharacterized ABC transporter ATP-binding protein Rv0986 | 49% | 207.2 |
| L-asparagine catabolism | aapP | lo | AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) | 35% | 86% | 131 | Uncharacterized ABC transporter ATP-binding protein Rv0986 | 49% | 207.2 |
| L-aspartate catabolism | aapP | lo | AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) | 35% | 86% | 131 | Uncharacterized ABC transporter ATP-binding protein Rv0986 | 49% | 207.2 |
| L-glutamate catabolism | aapP | lo | AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) | 35% | 86% | 131 | Uncharacterized ABC transporter ATP-binding protein Rv0986 | 49% | 207.2 |
| L-leucine catabolism | aapP | lo | AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) | 35% | 86% | 131 | Uncharacterized ABC transporter ATP-binding protein Rv0986 | 49% | 207.2 |
| L-proline catabolism | aapP | lo | AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) | 35% | 86% | 131 | Uncharacterized ABC transporter ATP-binding protein Rv0986 | 49% | 207.2 |
| D-cellobiose catabolism | gtsD | lo | ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) | 37% | 55% | 130.6 | Uncharacterized ABC transporter ATP-binding protein Rv0986 | 49% | 207.2 |
| D-glucose catabolism | gtsD | lo | ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) | 37% | 55% | 130.6 | Uncharacterized ABC transporter ATP-binding protein Rv0986 | 49% | 207.2 |
| lactose catabolism | gtsD | lo | ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) | 37% | 55% | 130.6 | Uncharacterized ABC transporter ATP-binding protein Rv0986 | 49% | 207.2 |
| D-maltose catabolism | gtsD | lo | ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) | 37% | 55% | 130.6 | Uncharacterized ABC transporter ATP-binding protein Rv0986 | 49% | 207.2 |
| sucrose catabolism | gtsD | lo | ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) | 37% | 55% | 130.6 | Uncharacterized ABC transporter ATP-binding protein Rv0986 | 49% | 207.2 |
| trehalose catabolism | gtsD | lo | ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) | 37% | 55% | 130.6 | Uncharacterized ABC transporter ATP-binding protein Rv0986 | 49% | 207.2 |
| D-xylose catabolism | gtsD | lo | ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) | 37% | 55% | 130.6 | Uncharacterized ABC transporter ATP-binding protein Rv0986 | 49% | 207.2 |
| L-citrulline catabolism | PS417_17605 | lo | ATP-binding cassette domain-containing protein; SubName: Full=Amino acid transporter; SubName: Full=Histidine ABC transporter ATP-binding protein; SubName: Full=Histidine transport system ATP-binding protein (characterized, see rationale) | 34% | 90% | 130.2 | Uncharacterized ABC transporter ATP-binding protein Rv0986 | 49% | 207.2 |
| D-alanine catabolism | Pf6N2E2_5405 | lo | ABC transporter for D-Alanine, ATPase component (characterized) | 34% | 90% | 129.8 | Uncharacterized ABC transporter ATP-binding protein Rv0986 | 49% | 207.2 |
| xylitol catabolism | HSERO_RS17020 | lo | ABC-type sugar transport system, ATPase component protein (characterized, see rationale) | 36% | 51% | 129.8 | Uncharacterized ABC transporter ATP-binding protein Rv0986 | 49% | 207.2 |
| putrescine catabolism | potA | lo | Spermidine/putrescine import ATP-binding protein PotA, component of The spermidine/putrescine uptake porter, PotABCD (characterized) | 37% | 54% | 127.1 | Uncharacterized ABC transporter ATP-binding protein Rv0986 | 49% | 207.2 |
| N-acetyl-D-glucosamine catabolism | SMc02869 | lo | N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) | 35% | 64% | 126.7 | Uncharacterized ABC transporter ATP-binding protein Rv0986 | 49% | 207.2 |
| D-glucosamine (chitosamine) catabolism | SMc02869 | lo | N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) | 35% | 64% | 126.7 | Uncharacterized ABC transporter ATP-binding protein Rv0986 | 49% | 207.2 |
| L-histidine catabolism | Ac3H11_2560 | lo | ABC transporter for L-Histidine, ATPase component (characterized) | 33% | 78% | 125.6 | Uncharacterized ABC transporter ATP-binding protein Rv0986 | 49% | 207.2 |
| D-galactose catabolism | PfGW456L13_1897 | lo | ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) | 36% | 55% | 124.8 | Uncharacterized ABC transporter ATP-binding protein Rv0986 | 49% | 207.2 |
| D-maltose catabolism | malK | lo | Maltose-transporting ATPase (EC 3.6.3.19) (characterized) | 34% | 54% | 119.4 | Uncharacterized ABC transporter ATP-binding protein Rv0986 | 49% | 207.2 |
| D-mannitol catabolism | mtlK | lo | SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter (characterized) | 34% | 63% | 119.4 | Uncharacterized ABC transporter ATP-binding protein Rv0986 | 49% | 207.2 |
| sucrose catabolism | thuK | lo | ABC transporter (characterized, see rationale) | 33% | 55% | 116.3 | Uncharacterized ABC transporter ATP-binding protein Rv0986 | 49% | 207.2 |
| lactose catabolism | lacK | lo | LacK, component of Lactose porter (characterized) | 32% | 58% | 115.5 | Uncharacterized ABC transporter ATP-binding protein Rv0986 | 49% | 207.2 |
| D-maltose catabolism | thuK | lo | ThuK aka RB0314 aka SMB20328, component of Trehalose/maltose/sucrose porter (trehalose inducible) (characterized) | 33% | 60% | 114 | Uncharacterized ABC transporter ATP-binding protein Rv0986 | 49% | 207.2 |
| D-maltose catabolism | aglK | lo | ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) | 33% | 59% | 110.5 | Uncharacterized ABC transporter ATP-binding protein Rv0986 | 49% | 207.2 |
| sucrose catabolism | aglK | lo | ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) | 33% | 59% | 110.5 | Uncharacterized ABC transporter ATP-binding protein Rv0986 | 49% | 207.2 |
| trehalose catabolism | aglK | lo | ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) | 33% | 59% | 110.5 | Uncharacterized ABC transporter ATP-binding protein Rv0986 | 49% | 207.2 |
| D-maltose catabolism | malK_Aa | lo | ABC-type maltose transporter (EC 7.5.2.1) (characterized) | 31% | 55% | 109.4 | Uncharacterized ABC transporter ATP-binding protein Rv0986 | 49% | 207.2 |
| xylitol catabolism | Dshi_0546 | lo | ABC transporter for Xylitol, ATPase component (characterized) | 33% | 62% | 109.4 | Uncharacterized ABC transporter ATP-binding protein Rv0986 | 49% | 207.2 |
| D-sorbitol (glucitol) catabolism | mtlK | lo | ABC transporter for D-Sorbitol, ATPase component (characterized) | 31% | 57% | 105.1 | Uncharacterized ABC transporter ATP-binding protein Rv0986 | 49% | 207.2 |
| D-maltose catabolism | musK | lo | ABC-type maltose transporter (EC 7.5.2.1) (characterized) | 31% | 57% | 100.9 | Uncharacterized ABC transporter ATP-binding protein Rv0986 | 49% | 207.2 |
Sequence Analysis Tools
View WP_014449258.1 at NCBI
Find papers: PaperBLAST
Find functional residues: SitesBLAST
Search for conserved domains
Find the best match in UniProt
Compare to protein structures
Predict transmenbrane helices: Phobius
Predict protein localization: PSORTb
Find homologs in fast.genomics
Fitness BLAST: loading...
Sequence
MKALLAPPDPTGLKVIATNVVKHYGESDPSRPPVIRGLSLSITEGEWVALMGDSGSGKST
LLNLLAGIDTPNGGEISIGGESMIAKSEKERTLFRRKHMGFVFQFFNLFPTLSVLENVLL
PARLLHFDKKQAKQQALSLLGEVGLFGKDHRFPSQLSGGEQQRVAIVRALIHRPRLILAD
EPTGSLDHDTGEGILALLKKLHQRDRPTIIMTTHSLDASLHAQRTIRIRDGQILPENQEF
SH
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Links
Downloads
Related tools
About GapMind
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using
ublast (a fast alternative to protein BLAST)
against a database of manually-curated proteins (most of which are experimentally characterized) or by using
HMMer with enzyme models (usually from
TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
- ublast finds a hit to a characterized protein at above 40% identity and 80% coverage, and bits >= other bits+10.
- (Hits to curated proteins without experimental data as to their function are never considered high confidence.)
- HMMer finds a hit with 80% coverage of the model, and either other identity < 40 or other coverage < 0.75.
where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").
Otherwise, a candidate is "medium confidence" if either:
- ublast finds a hit at above 40% identity and 70% coverage (ignoring otherBits).
- ublast finds a hit at above 30% identity and 80% coverage, and bits >= other bits.
- HMMer finds a hit (regardless of coverage or other bits).
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps."
For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways.
For diverse bacteria and archaea that can utilize a carbon source, there is a complete
high-confidence catabolic pathway (including a transporter) just 38% of the time, and
there is a complete medium-confidence pathway 63% of the time.
Gaps may be due to:
- our ignorance of proteins' functions,
- omissions in the gene models,
- frame-shift errors in the genome sequence, or
- the organism lacks the pathway.
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory