GapMind for catabolism of small carbon sources

 

Protein WP_014449258.1 in Leptospirillum ferrooxidans C2-3

Annotation: NCBI__GCF_000284315.1:WP_014449258.1

Length: 242 amino acids

Source: GCF_000284315.1 in NCBI

Candidate for 43 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
L-lysine catabolism hisP lo Amino-acid ABC transporter, ATP-binding protein (characterized, see rationale) 39% 88% 153.7 Uncharacterized ABC transporter ATP-binding protein Rv0986 49% 207.2
L-arginine catabolism artP lo Probable ATP-binding component of ABC transporter, component of Amino acid transporter, PA5152-PA5155. Probably transports numerous amino acids including lysine, arginine, histidine, D-alanine and D-valine (Johnson et al. 2008). Regulated by ArgR (characterized) 38% 79% 147.5 Uncharacterized ABC transporter ATP-binding protein Rv0986 49% 207.2
L-histidine catabolism hisP lo Probable ATP-binding component of ABC transporter, component of Amino acid transporter, PA5152-PA5155. Probably transports numerous amino acids including lysine, arginine, histidine, D-alanine and D-valine (Johnson et al. 2008). Regulated by ArgR (characterized) 38% 79% 147.5 Uncharacterized ABC transporter ATP-binding protein Rv0986 49% 207.2
L-asparagine catabolism peb1C lo PEB1C, component of Uptake system for glutamate and aspartate (characterized) 38% 90% 147.1 Uncharacterized ABC transporter ATP-binding protein Rv0986 49% 207.2
L-aspartate catabolism peb1C lo PEB1C, component of Uptake system for glutamate and aspartate (characterized) 38% 90% 147.1 Uncharacterized ABC transporter ATP-binding protein Rv0986 49% 207.2
L-glutamate catabolism gltL lo PEB1C, component of Uptake system for glutamate and aspartate (characterized) 38% 90% 147.1 Uncharacterized ABC transporter ATP-binding protein Rv0986 49% 207.2
L-histidine catabolism BPHYT_RS24015 lo ABC transporter related (characterized, see rationale) 35% 86% 139.4 Uncharacterized ABC transporter ATP-binding protein Rv0986 49% 207.2
L-asparagine catabolism bgtA lo ATPase (characterized, see rationale) 37% 87% 139 Uncharacterized ABC transporter ATP-binding protein Rv0986 49% 207.2
L-aspartate catabolism bgtA lo ATPase (characterized, see rationale) 37% 87% 139 Uncharacterized ABC transporter ATP-binding protein Rv0986 49% 207.2
D-glucosamine (chitosamine) catabolism SM_b21216 lo ABC transporter for D-Glucosamine, ATPase component (characterized) 38% 57% 137.1 Uncharacterized ABC transporter ATP-binding protein Rv0986 49% 207.2
L-histidine catabolism aapP lo ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component (characterized) 36% 88% 132.5 Uncharacterized ABC transporter ATP-binding protein Rv0986 49% 207.2
L-asparagine catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 35% 86% 131 Uncharacterized ABC transporter ATP-binding protein Rv0986 49% 207.2
L-aspartate catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 35% 86% 131 Uncharacterized ABC transporter ATP-binding protein Rv0986 49% 207.2
L-glutamate catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 35% 86% 131 Uncharacterized ABC transporter ATP-binding protein Rv0986 49% 207.2
L-leucine catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 35% 86% 131 Uncharacterized ABC transporter ATP-binding protein Rv0986 49% 207.2
L-proline catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 35% 86% 131 Uncharacterized ABC transporter ATP-binding protein Rv0986 49% 207.2
D-cellobiose catabolism gtsD lo ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 37% 55% 130.6 Uncharacterized ABC transporter ATP-binding protein Rv0986 49% 207.2
D-glucose catabolism gtsD lo ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 37% 55% 130.6 Uncharacterized ABC transporter ATP-binding protein Rv0986 49% 207.2
lactose catabolism gtsD lo ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 37% 55% 130.6 Uncharacterized ABC transporter ATP-binding protein Rv0986 49% 207.2
D-maltose catabolism gtsD lo ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 37% 55% 130.6 Uncharacterized ABC transporter ATP-binding protein Rv0986 49% 207.2
sucrose catabolism gtsD lo ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 37% 55% 130.6 Uncharacterized ABC transporter ATP-binding protein Rv0986 49% 207.2
trehalose catabolism gtsD lo ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 37% 55% 130.6 Uncharacterized ABC transporter ATP-binding protein Rv0986 49% 207.2
D-xylose catabolism gtsD lo ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 37% 55% 130.6 Uncharacterized ABC transporter ATP-binding protein Rv0986 49% 207.2
L-citrulline catabolism PS417_17605 lo ATP-binding cassette domain-containing protein; SubName: Full=Amino acid transporter; SubName: Full=Histidine ABC transporter ATP-binding protein; SubName: Full=Histidine transport system ATP-binding protein (characterized, see rationale) 34% 90% 130.2 Uncharacterized ABC transporter ATP-binding protein Rv0986 49% 207.2
D-alanine catabolism Pf6N2E2_5405 lo ABC transporter for D-Alanine, ATPase component (characterized) 34% 90% 129.8 Uncharacterized ABC transporter ATP-binding protein Rv0986 49% 207.2
xylitol catabolism HSERO_RS17020 lo ABC-type sugar transport system, ATPase component protein (characterized, see rationale) 36% 51% 129.8 Uncharacterized ABC transporter ATP-binding protein Rv0986 49% 207.2
putrescine catabolism potA lo Spermidine/putrescine import ATP-binding protein PotA, component of The spermidine/putrescine uptake porter, PotABCD (characterized) 37% 54% 127.1 Uncharacterized ABC transporter ATP-binding protein Rv0986 49% 207.2
N-acetyl-D-glucosamine catabolism SMc02869 lo N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 35% 64% 126.7 Uncharacterized ABC transporter ATP-binding protein Rv0986 49% 207.2
D-glucosamine (chitosamine) catabolism SMc02869 lo N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 35% 64% 126.7 Uncharacterized ABC transporter ATP-binding protein Rv0986 49% 207.2
L-histidine catabolism Ac3H11_2560 lo ABC transporter for L-Histidine, ATPase component (characterized) 33% 78% 125.6 Uncharacterized ABC transporter ATP-binding protein Rv0986 49% 207.2
D-galactose catabolism PfGW456L13_1897 lo ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) 36% 55% 124.8 Uncharacterized ABC transporter ATP-binding protein Rv0986 49% 207.2
D-maltose catabolism malK lo Maltose-transporting ATPase (EC 3.6.3.19) (characterized) 34% 54% 119.4 Uncharacterized ABC transporter ATP-binding protein Rv0986 49% 207.2
D-mannitol catabolism mtlK lo SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter (characterized) 34% 63% 119.4 Uncharacterized ABC transporter ATP-binding protein Rv0986 49% 207.2
sucrose catabolism thuK lo ABC transporter (characterized, see rationale) 33% 55% 116.3 Uncharacterized ABC transporter ATP-binding protein Rv0986 49% 207.2
lactose catabolism lacK lo LacK, component of Lactose porter (characterized) 32% 58% 115.5 Uncharacterized ABC transporter ATP-binding protein Rv0986 49% 207.2
D-maltose catabolism thuK lo ThuK aka RB0314 aka SMB20328, component of Trehalose/maltose/sucrose porter (trehalose inducible) (characterized) 33% 60% 114 Uncharacterized ABC transporter ATP-binding protein Rv0986 49% 207.2
D-maltose catabolism aglK lo ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 33% 59% 110.5 Uncharacterized ABC transporter ATP-binding protein Rv0986 49% 207.2
sucrose catabolism aglK lo ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 33% 59% 110.5 Uncharacterized ABC transporter ATP-binding protein Rv0986 49% 207.2
trehalose catabolism aglK lo ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 33% 59% 110.5 Uncharacterized ABC transporter ATP-binding protein Rv0986 49% 207.2
D-maltose catabolism malK_Aa lo ABC-type maltose transporter (EC 7.5.2.1) (characterized) 31% 55% 109.4 Uncharacterized ABC transporter ATP-binding protein Rv0986 49% 207.2
xylitol catabolism Dshi_0546 lo ABC transporter for Xylitol, ATPase component (characterized) 33% 62% 109.4 Uncharacterized ABC transporter ATP-binding protein Rv0986 49% 207.2
D-sorbitol (glucitol) catabolism mtlK lo ABC transporter for D-Sorbitol, ATPase component (characterized) 31% 57% 105.1 Uncharacterized ABC transporter ATP-binding protein Rv0986 49% 207.2
D-maltose catabolism musK lo ABC-type maltose transporter (EC 7.5.2.1) (characterized) 31% 57% 100.9 Uncharacterized ABC transporter ATP-binding protein Rv0986 49% 207.2

Sequence Analysis Tools

View WP_014449258.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MKALLAPPDPTGLKVIATNVVKHYGESDPSRPPVIRGLSLSITEGEWVALMGDSGSGKST
LLNLLAGIDTPNGGEISIGGESMIAKSEKERTLFRRKHMGFVFQFFNLFPTLSVLENVLL
PARLLHFDKKQAKQQALSLLGEVGLFGKDHRFPSQLSGGEQQRVAIVRALIHRPRLILAD
EPTGSLDHDTGEGILALLKKLHQRDRPTIIMTTHSLDASLHAQRTIRIRDGQILPENQEF
SH

This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory