Align CbtD, component of Cellobiose and cellooligosaccharide porter (characterized)
to candidate WP_014448908.1 LFE_RS03575 ATP-binding cassette domain-containing protein
Query= TCDB::Q97VF5 (362 letters) >NCBI__GCF_000284315.1:WP_014448908.1 Length = 314 Score = 91.7 bits (226), Expect = 2e-23 Identities = 75/232 (32%), Positives = 119/232 (51%), Gaps = 20/232 (8%) Query: 61 RIIKAVNDVSFGVEKGEILGIIGESGSGKTTLISAILRAIRPPGKIISGKVIFNGMDIFS 120 + I AV+ +SF V+KGE ++G +G+GKTT IS + + P SG V NG+D+ Sbjct: 16 KTITAVDSISFEVQKGEFFSLLGPNGAGKTTTISILSTILSPT----SGHVFINGIDVQK 71 Query: 121 MT--IDEFRKLLWKDISYVPQASQNALNPVLPISEIFYHEAISHGEADKKRVIERASELL 178 + + ++++D S L+ L E +G R ++R+ LL Sbjct: 72 DPHGVRQHIGVIFQDPS---------LDDRLSAQENMDFHGRLYGMKPSDR-LQRSEILL 121 Query: 179 KLVGLDPARVLKMYPFQLSGGMKQRVMIALSLLLNPKLILMDEPTSALDMLNQELLLKLI 238 K+V L R + F SGGMK+R+ IA L+ P L+++DEPT LD ++ + + I Sbjct: 122 KMVDLWDRRNSLIRTF--SGGMKRRLEIARGLMHRPLLLILDEPTIGLDPKSRRDIWQYI 179 Query: 239 KNINQEMGVTIVYVTHDILNIAQIANRLLVMYKGYVMEEGKTEEIIKSPLNP 290 +E +TI+ TH L A A+R+ +M KG ++ T I+KS L P Sbjct: 180 HQARKEWAMTILLTTH-YLEEADGADRVAIMNKGKIVAM-DTPGILKSSLGP 229 Lambda K H 0.319 0.138 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 224 Number of extensions: 14 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 362 Length of database: 314 Length adjustment: 28 Effective length of query: 334 Effective length of database: 286 Effective search space: 95524 Effective search space used: 95524 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory