Align ABC transporter for L-Fucose, ATPase component (characterized)
to candidate WP_232502546.1 LFE_RS01565 ABC transporter ATP-binding protein
Query= reanno::Smeli:SM_b21106 (365 letters) >NCBI__GCF_000284315.1:WP_232502546.1 Length = 251 Score = 127 bits (320), Expect = 2e-34 Identities = 77/195 (39%), Positives = 109/195 (55%), Gaps = 12/195 (6%) Query: 19 VHGIDLEVKDREFIALVGPSGCGKSTTLRMIAGLEEVSGGAIEIGGRK---VNDLPPRAR 75 + + L + + EF+++VGPSGCGKST LR++ GL + G + G VN Sbjct: 25 IRDLSLSIDEGEFVSIVGPSGCGKSTLLRILQGLISPTRGEVLYRGSPSLGVNG------ 78 Query: 76 NISMVFQSYALYPHMTVAENMGFSLKIAGRPAEEIKTRVAEAAAILDLAHLLERRPSQLS 135 ++ MVFQ +AL+P MTV EN+G L G P EI VA + L E P +LS Sbjct: 79 DMGMVFQGFALFPWMTVRENVGIGLVAQGLPKSEISRSVAFYIDKVGLEGYEEAYPRELS 138 Query: 136 GGQRQRVAMGRAIVRQPDVFLFDEPLSNLDAKLRTQVRTEIKKLHARMQ---ATMIYVTH 192 GG +QRV + RA+ +P + L DEP SNLDA +R E+ L + T+I VTH Sbjct: 139 GGMKQRVGIARALCMEPAILLMDEPFSNLDALTSLTLRDEVLMLWQDPEMSVRTIIMVTH 198 Query: 193 DQVEAMTLSDRIVIM 207 EA+ +SDR+V++ Sbjct: 199 IIEEAILMSDRVVVL 213 Lambda K H 0.320 0.137 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 216 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 365 Length of database: 251 Length adjustment: 27 Effective length of query: 338 Effective length of database: 224 Effective search space: 75712 Effective search space used: 75712 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory