Align ABC transporter for D-Glucosamine, ATPase component (characterized)
to candidate WP_232502546.1 LFE_RS01565 ABC transporter ATP-binding protein
Query= reanno::Smeli:SM_b21216 (360 letters) >NCBI__GCF_000284315.1:WP_232502546.1 Length = 251 Score = 136 bits (343), Expect = 5e-37 Identities = 74/192 (38%), Positives = 117/192 (60%), Gaps = 6/192 (3%) Query: 19 LKGIDIALESGEFLVLLGSSGCGKSTLLNIIAGLAEPSGGDILIGERSVLGVHPKDRDIA 78 ++ + ++++ GEF+ ++G SGCGKSTLL I+ GL P+ G++L LGV+ D+ Sbjct: 25 IRDLSLSIDEGEFVSIVGPSGCGKSTLLRILQGLISPTRGEVLYRGSPSLGVNG---DMG 81 Query: 79 MVFQSYALYPNLSVARNIGFGLEMRRVPQAEHDKAVRDTARLLQIENLLDRKPSQLSGGQ 138 MVFQ +AL+P ++V N+G GL + +P++E ++V + +E + P +LSGG Sbjct: 82 MVFQGFALFPWMTVRENVGIGLVAQGLPKSEISRSVAFYIDKVGLEGYEEAYPRELSGGM 141 Query: 139 RQRVAIGRALVRNPQVFLFDEPLSNLDAKLRMEMRTELKRLHQ---MLRTTVVYVTHDQI 195 +QRV I RAL P + L DEP SNLDA + +R E+ L Q M T++ VTH Sbjct: 142 KQRVGIARALCMEPAILLMDEPFSNLDALTSLTLRDEVLMLWQDPEMSVRTIIMVTHIIE 201 Query: 196 EAMTLATRIAVM 207 EA+ ++ R+ V+ Sbjct: 202 EAILMSDRVVVL 213 Lambda K H 0.320 0.136 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 195 Number of extensions: 5 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 360 Length of database: 251 Length adjustment: 27 Effective length of query: 333 Effective length of database: 224 Effective search space: 74592 Effective search space used: 74592 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory