Align High-affinity branched-chain amino acid transport ATP-binding protein LivG aka B3455, component of Leucine; leucine/isoleucine/valine porter (characterized)
to candidate WP_014448908.1 LFE_RS03575 ATP-binding cassette domain-containing protein
Query= TCDB::P0A9S7 (255 letters) >NCBI__GCF_000284315.1:WP_014448908.1 Length = 314 Score = 100 bits (249), Expect = 4e-26 Identities = 69/227 (30%), Positives = 118/227 (51%), Gaps = 18/227 (7%) Query: 18 LLAVNNVNLELYPQEIVSLIGPNGAGKTTVFNCLTGFYKPTGGTILLRDQHLEGLPGQQI 77 + AV++++ E+ E SL+GPNGAGKTT + L+ PT G + + ++ P Sbjct: 18 ITAVDSISFEVQKGEFFSLLGPNGAGKTTTISILSTILSPTSGHVFINGIDVQKDPHGVR 77 Query: 78 ARMGVVRTFQHVRLFREMTVIENLLVAQHQQLKTGLFSGLLKTPSFRRAQSEALDRAATW 137 +GV+ FQ L ++ EN+ F G L + S+ L R+ Sbjct: 78 QHIGVI--FQDPSLDDRLSAQENMD-----------FHGRL----YGMKPSDRLQRSEIL 120 Query: 138 LERIGLLEHANRQASNLAYGDQRRLEIARCMVTQPEILMLDEPAAGLNPKETKELDELIA 197 L+ + L + N + G +RRLEIAR ++ +P +L+LDEP GL+PK +++ + I Sbjct: 121 LKMVDLWDRRNSLIRTFSGGMKRRLEIARGLMHRPLLLILDEPTIGLDPKSRRDIWQYIH 180 Query: 198 ELRNHHNTTILLIEHDMKLVMGISDRIYVVNQGTPLANGTPEQIRNN 244 + R TILL H ++ G +DR+ ++N+G +A TP ++++ Sbjct: 181 QARKEWAMTILLTTHYLEEADG-ADRVAIMNKGKIVAMDTPGILKSS 226 Lambda K H 0.320 0.137 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 193 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 314 Length adjustment: 26 Effective length of query: 229 Effective length of database: 288 Effective search space: 65952 Effective search space used: 65952 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory