Align High-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG (characterized, see rationale)
to candidate WP_014450302.1 LFE_RS11030 ABC transporter ATP-binding protein
Query= uniprot:A0A159ZWS6 (255 letters) >NCBI__GCF_000284315.1:WP_014450302.1 Length = 253 Score = 125 bits (314), Expect = 8e-34 Identities = 79/245 (32%), Positives = 125/245 (51%), Gaps = 16/245 (6%) Query: 6 LKVENLSMRFGGLLAVNGVALTVKEKQVVALIGPNGAGKTTVFNCLTGFYQPTGGTILLD 65 L +ENL+ FG + G++ TV E + V +IG +G GK+ + + G +L+ Sbjct: 7 LTIENLTKSFGRQKVLKGISFTVPEGETVVVIGGSGQGKSVLLKHVMRLLVADEGDVLVG 66 Query: 66 GEPIQGLPGHHI--ARKGVVRTFQNVRLFKDMTAVENLLIAQHRHLNTNFFAGLFKTPAF 123 G+PI L + RKG+ FQ LF M+ +EN+ H +GL Sbjct: 67 GQPIMKLTSREMDEVRKGMGMVFQEAALFDSMSLLENVAFPLRMH------SGL------ 114 Query: 124 RKSEREAMEYAEYWLDKVNLTEFANRPAGTLAYGQQRRLEIARCMMTRPRILMLDEPAAG 183 +RE ++ AE L++V L + ++ G ++R+ IAR + RP IL+ DEP G Sbjct: 115 --RDREIIKIAEENLERVGLRGVGGKMPSEVSGGMKKRVGIARAISMRPGILLYDEPTTG 172 Query: 184 LNPKETEDLKALIGVLREEHNVTVLLIEHDMKLVMSISDHIVVINQGTPLADGTPEQIRD 243 L+P + + LI +R E VT L+I HDMK I+D I+ + QG A GTP +I+ Sbjct: 173 LDPVLSSAIDELILKMRSELGVTSLVISHDMKSAFRIADKIIFLYQGVIQASGTPAEIQA 232 Query: 244 NPEVI 248 + + + Sbjct: 233 SKDPV 237 Lambda K H 0.321 0.138 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 169 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 253 Length adjustment: 24 Effective length of query: 231 Effective length of database: 229 Effective search space: 52899 Effective search space used: 52899 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory