Align ABC-type maltose transporter (EC 7.5.2.1) (characterized)
to candidate WP_014449258.1 LFE_RS05545 ABC transporter ATP-binding protein
Query= BRENDA::Q8NMV1 (376 letters) >NCBI__GCF_000284315.1:WP_014449258.1 Length = 242 Score = 97.8 bits (242), Expect = 3e-25 Identities = 68/223 (30%), Positives = 114/223 (51%), Gaps = 14/223 (6%) Query: 1 MATVTFKDASLSYPGAKEPTVKKFNLEIADGEFLVLVGPSGCGKSTTLRMLAGLENVTDG 60 +AT K S P ++ P ++ +L I +GE++ L+G SG GKST L +LAG++ G Sbjct: 16 IATNVVKHYGESDP-SRPPVIRGLSLSITEGEWVALMGDSGSGKSTLLNLLAGIDTPNGG 74 Query: 61 AIFIGDKDVTHVAPRDRDI------AMVFQNYALYPHMTVGENMGFALKIAGKSQDEINK 114 I IG + + + ++R + VFQ + L+P ++V EN+ ++ + + + Sbjct: 75 EISIGGESMIAKSEKERTLFRRKHMGFVFQFFNLFPTLSVLENVLLPARLLHFDKKQAKQ 134 Query: 115 RVDEAAATLGLTEFLERKPKALSGGQRQRVAMGRAIVRNPQVFLMDEPLSNLDAKLRVQT 174 + +GL R P LSGG++QRVA+ RA++ P++ L DEP +LD T Sbjct: 135 QALSLLGEVGLFGKDHRFPSQLSGGEQQRVAIVRALIHRPRLILADEPTGSLDH----DT 190 Query: 175 RTQIAALQRKL---GVTTVYVTHDQTEALTMGDRIAVLKDGYL 214 I AL +KL T+ +T +A R ++DG + Sbjct: 191 GEGILALLKKLHQRDRPTIIMTTHSLDASLHAQRTIRIRDGQI 233 Lambda K H 0.316 0.135 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 228 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 376 Length of database: 242 Length adjustment: 27 Effective length of query: 349 Effective length of database: 215 Effective search space: 75035 Effective search space used: 75035 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory