Align high-affinity branched-chain amino acid ABC transporter, ATP-binding protein LivF (characterized)
to candidate WP_014448908.1 LFE_RS03575 ATP-binding cassette domain-containing protein
Query= CharProtDB::CH_003736 (237 letters) >NCBI__GCF_000284315.1:WP_014448908.1 Length = 314 Score = 90.9 bits (224), Expect = 3e-23 Identities = 70/226 (30%), Positives = 113/226 (50%), Gaps = 17/226 (7%) Query: 5 MLSFDKVSAHYGK----IQALHEVSLHINQGEIVTLIGANGAGKTTLLGTLCGDPRATSG 60 M+ DK+ Y + I A+ +S + +GE +L+G NGAGKTT + L TSG Sbjct: 1 MIHVDKLRKDYLQKRKTITAVDSISFEVQKGEFFSLLGPNGAGKTTTISILSTILSPTSG 60 Query: 61 RIVFDDKDITDWQTAKIMREAVAIVPEGRRVFSRMTVEENLAMGGFF-----AERDQFQE 115 + + D+ + +R+ + ++ + + R++ +EN+ G ++R Q E Sbjct: 61 HVFINGIDVQ--KDPHGVRQHIGVIFQDPSLDDRLSAQENMDFHGRLYGMKPSDRLQRSE 118 Query: 116 RIKWVYELFPRLHERRIQRAGTMSGGEQQMLAIGRALMSNPRLLLLDEPSLGLAPIIIQQ 175 + + +L+ +RR T SGG ++ L I R LM P LL+LDEP++GL P + Sbjct: 119 ILLKMVDLW----DRRNSLIRTFSGGMKRRLEIARGLMHRPLLLILDEPTIGLDPKSRRD 174 Query: 176 IFDTIEQLR-EQGMTIFLVEQNANQALKLADRGYVLENGHVVLSDT 220 I+ I Q R E MTI L +A ADR ++ G +V DT Sbjct: 175 IWQYIHQARKEWAMTILLTTHYLEEA-DGADRVAIMNKGKIVAMDT 219 Lambda K H 0.321 0.137 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 156 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 237 Length of database: 314 Length adjustment: 25 Effective length of query: 212 Effective length of database: 289 Effective search space: 61268 Effective search space used: 61268 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory