Align ABC-type branched-chain amino acid transport system, ATPase component protein (characterized, see rationale)
to candidate WP_232502519.1 LFE_RS09120 ATP-binding cassette domain-containing protein
Query= uniprot:D8IUY7 (241 letters) >NCBI__GCF_000284315.1:WP_232502519.1 Length = 588 Score = 85.1 bits (209), Expect = 3e-21 Identities = 60/186 (32%), Positives = 102/186 (54%), Gaps = 15/186 (8%) Query: 16 GGIQAVKGIDLEVNEGELVTLIGANGAGKTTTLKAITGTLPASRVEGHIEYLGQ-PLKGK 74 G + A+ I + +G + LIG +GAGKTT ++ ++G L G I +G P K Sbjct: 25 GIVTALDKISFSLKKGSITGLIGPDGAGKTTLMRLLSGLLWPDG--GDIRIMGNDPSKAP 82 Query: 75 KSFELVKDKLAMVPEGRGVFTRMSIQENLLMGA----YTSDDKGQIAADIDKWFAVFPRL 130 S V+ L +P+ G++ +S+QENL + A D + ++ A + + P Sbjct: 83 LS---VQGSLGYMPQKFGLYEDLSVQENLDLYANLQGVPKDRRKELYAPLLSMTGLSPFQ 139 Query: 131 KERAAQMAGTLSGGEQQMLAMARALMSHPKLLLLDEPSMGLSPIMVEKIFEVIRN-VSAQ 189 K ++AG LSGG +Q L +A +L+ P +LLLDEP++G+ P+ +++E++R VS Sbjct: 140 K----RLAGQLSGGMKQKLGVACSLVHQPPILLLDEPTVGVDPVSRRELWEILRKLVSES 195 Query: 190 GITILL 195 G T+ + Sbjct: 196 GATLFV 201 Score = 80.5 bits (197), Expect = 7e-20 Identities = 55/227 (24%), Positives = 112/227 (49%), Gaps = 5/227 (2%) Query: 6 LKVQQLSVAYGGIQAVKGIDLEVNEGELVTLIGANGAGKTTTLKAITGTLPASRVEGHIE 65 ++V+ L + +AV + V +GE+ L+GANGAGKTTT + + G L + G + Sbjct: 342 IEVENLDRYFDSFKAVNNLTFHVKKGEVFGLLGANGAGKTTTFRMLAGLLEPT--AGKLI 399 Query: 66 YLGQPLKGKKSFELVKDKLAMVPEGRGVFTRMSIQENLLMGAYTSDDKGQIAADIDKWFA 125 G+ + +K + K+ + + +++++++ +NL+ + G + + + Sbjct: 400 VAGEDV--RKVAAQARGKIGYMAQKFSLYSQLTVFQNLIFYSSAYGLSGTLQKEKIQDSL 457 Query: 126 VFPRLKERAAQMAGTLSGGEQQMLAMARALMSHPKLLLLDEPSMGLSPIMVEKIFEVIRN 185 F L+ +G L G +Q LA++ AL+ P +L LDEP+ G+ P + + +I Sbjct: 458 NFFELEPYKNVSSGILPLGFRQRLALSCALIHEPSILFLDEPTSGVDPNARREFWHIINA 517 Query: 186 VSAQGITILLVEQNAKLALEAAHRGYVMESGLITMQGQAQQMLDDPR 232 ++ G+++L+ + A E R +M G + G ++ + R Sbjct: 518 LATVGVSVLVTTHFMEEA-EYCDRLLIMAQGALLAMGSPAEIKEKTR 563 Lambda K H 0.317 0.134 0.365 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 300 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 241 Length of database: 588 Length adjustment: 30 Effective length of query: 211 Effective length of database: 558 Effective search space: 117738 Effective search space used: 117738 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory