Align ABC transporter for D-Sorbitol, ATPase component (characterized)
to candidate WP_232502546.1 LFE_RS01565 ABC transporter ATP-binding protein
Query= reanno::Phaeo:GFF1302 (334 letters) >NCBI__GCF_000284315.1:WP_232502546.1 Length = 251 Score = 139 bits (351), Expect = 6e-38 Identities = 85/215 (39%), Positives = 121/215 (56%), Gaps = 12/215 (5%) Query: 19 IPPLDLTIEDGEFTVFVGPSGCGKSTLLRLIAGLEDITSGTIRIDGEDATNIPPAKRGLA 78 I L L+I++GEF VGPSGCGKSTLLR++ GL T G + G + + + Sbjct: 25 IRDLSLSIDEGEFVSIVGPSGCGKSTLLRILQGLISPTRGEVLYRGSPSLGV---NGDMG 81 Query: 79 MVFQSYALYPHMSVRKNIAFPMKMAGIPADEQKRRIDNAAAALNLTDYLDRRPGQLSGGQ 138 MVFQ +AL+P M+VR+N+ + G+P E R + + L Y + P +LSGG Sbjct: 82 MVFQGFALFPWMTVRENVGIGLVAQGLPKSEISRSVAFYIDKVGLEGYEEAYPRELSGGM 141 Query: 139 RQRVAIGRAIVREPAAFLFDEPLSNLDAALRVGMRLEISEL---HKRLATTMIYVTHDQV 195 +QRV I RA+ EPA L DEP SNLDA + +R E+ L + T+I VTH Sbjct: 142 KQRVGIARALCMEPAILLMDEPFSNLDALTSLTLRDEVLMLWQDPEMSVRTIIMVTHIIE 201 Query: 196 EAMTMADKIVVLQ---AGVIEQVGSPMELYRAPRN 227 EA+ M+D++VVL V+E++ + R PR+ Sbjct: 202 EAILMSDRVVVLSRRPTHVVEEISVDL---RRPRD 233 Lambda K H 0.320 0.138 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 202 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 334 Length of database: 251 Length adjustment: 26 Effective length of query: 308 Effective length of database: 225 Effective search space: 69300 Effective search space used: 69300 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory