Align ABC transporter ATP-binding protein-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized)
to candidate WP_014449661.1 LFE_RS07695 LPS export ABC transporter ATP-binding protein
Query= TCDB::Q8DQH7 (236 letters) >NCBI__GCF_000284315.1:WP_014449661.1 Length = 247 Score = 148 bits (373), Expect = 1e-40 Identities = 87/233 (37%), Positives = 133/233 (57%), Gaps = 2/233 (0%) Query: 4 LKVENLSVHYGMIQAVRDVSFEVNEGEVVSLIGANGAGKTTILRTLSGLVRPSSGKIEFL 63 + V +L +Y V V+ V++GEVV L+G NGAGKTT + GLVRP GKI Sbjct: 3 ITVSDLKKNYRKRWVVGGVNLNVSQGEVVGLLGPNGAGKTTTFYMIVGLVRPDGGKILMD 62 Query: 64 GQEIQKMPAQKIVAGGLSQVPEGRHVFPGLTVMENL-EMGAFLKKNREENQANLKKVFSR 122 EI +P G+S +P+ +F LTV EN+ + ++ +R E Q+ L+ + Sbjct: 63 DDEISHLPVHMRARKGISYLPQESSIFRKLTVSENIMAVLEYMDLSRSERQSRLETLLGE 122 Query: 123 FPRLEERKNQDAATLSGGEQQMLAMGRALMSTPKLLLLDEPSMGLAPIFIQEIFDIIQDI 182 KN+ A TLSGGE++ + + RAL + P+ +LLDEP G+ PI + +I II D+ Sbjct: 123 LNISHLTKNK-AYTLSGGERRRVEVARALATKPRYILLDEPFAGVDPIAVIDIQKIIADL 181 Query: 183 QKQGTTVLLIEQNANKALAISDRGYVLETGKIVLSGTGKELASSEEVRKAYLG 235 +++ VL+ + N + L I+DR YV+ G I+ GT E+A+S + + YLG Sbjct: 182 KRRDIGVLITDHNVRETLEITDRAYVINQGMILEEGTPFEVANSPKAKAFYLG 234 Lambda K H 0.315 0.134 0.358 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 147 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 236 Length of database: 247 Length adjustment: 23 Effective length of query: 213 Effective length of database: 224 Effective search space: 47712 Effective search space used: 47712 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory