GapMind for catabolism of small carbon sources

 

Protein WP_004304861.1 in Thauera aminoaromatica S2

Annotation: NCBI__GCF_000310185.1:WP_004304861.1

Length: 365 amino acids

Source: GCF_000310185.1 in NCBI

Candidate for 52 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
putrescine catabolism potA med spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 (characterized) 43% 84% 242.7 CysA aka B2422, component of Sulfate/thiosulfate porter 62% 342.0
D-maltose catabolism thuK med Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 (characterized) 43% 78% 226.9 CysA aka B2422, component of Sulfate/thiosulfate porter 62% 342.0
trehalose catabolism thuK med Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 (characterized) 43% 78% 226.9 CysA aka B2422, component of Sulfate/thiosulfate porter 62% 342.0
D-cellobiose catabolism gtsD med GtsD (GLcK), component of Glucose porter, GtsABCD (characterized) 40% 78% 226.1 CysA aka B2422, component of Sulfate/thiosulfate porter 62% 342.0
D-glucose catabolism gtsD med GtsD (GLcK), component of Glucose porter, GtsABCD (characterized) 40% 78% 226.1 CysA aka B2422, component of Sulfate/thiosulfate porter 62% 342.0
lactose catabolism gtsD med GtsD (GLcK), component of Glucose porter, GtsABCD (characterized) 40% 78% 226.1 CysA aka B2422, component of Sulfate/thiosulfate porter 62% 342.0
D-maltose catabolism gtsD med GtsD (GLcK), component of Glucose porter, GtsABCD (characterized) 40% 78% 226.1 CysA aka B2422, component of Sulfate/thiosulfate porter 62% 342.0
sucrose catabolism gtsD med GtsD (GLcK), component of Glucose porter, GtsABCD (characterized) 40% 78% 226.1 CysA aka B2422, component of Sulfate/thiosulfate porter 62% 342.0
trehalose catabolism gtsD med GtsD (GLcK), component of Glucose porter, GtsABCD (characterized) 40% 78% 226.1 CysA aka B2422, component of Sulfate/thiosulfate porter 62% 342.0
xylitol catabolism Dshi_0546 med ABC transporter for Xylitol, ATPase component (characterized) 42% 89% 221.1 CysA aka B2422, component of Sulfate/thiosulfate porter 62% 342.0
D-maltose catabolism malK_Bb med ABC-type maltose transport, ATP binding protein (characterized, see rationale) 43% 78% 220.7 CysA aka B2422, component of Sulfate/thiosulfate porter 62% 342.0
D-galactose catabolism PfGW456L13_1897 med ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) 41% 77% 219.2 CysA aka B2422, component of Sulfate/thiosulfate porter 62% 342.0
L-fucose catabolism SM_b21106 med ABC transporter for L-Fucose, ATPase component (characterized) 41% 79% 218.8 CysA aka B2422, component of Sulfate/thiosulfate porter 62% 342.0
D-maltose catabolism malK1 med MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized) 43% 70% 218 CysA aka B2422, component of Sulfate/thiosulfate porter 62% 342.0
N-acetyl-D-glucosamine catabolism SMc02869 med N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 40% 80% 211.5 CysA aka B2422, component of Sulfate/thiosulfate porter 62% 342.0
D-glucosamine (chitosamine) catabolism SMc02869 med N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 40% 80% 211.5 CysA aka B2422, component of Sulfate/thiosulfate porter 62% 342.0
D-maltose catabolism malK_Aa med ABC-type maltose transporter (EC 7.5.2.1) (characterized) 41% 71% 206.1 CysA aka B2422, component of Sulfate/thiosulfate porter 62% 342.0
D-maltose catabolism musK med ABC-type maltose transporter (EC 7.5.2.1) (characterized) 40% 72% 196.1 CysA aka B2422, component of Sulfate/thiosulfate porter 62% 342.0
trehalose catabolism treV med TreV, component of Trehalose porter (characterized) 41% 77% 193 CysA aka B2422, component of Sulfate/thiosulfate porter 62% 342.0
L-histidine catabolism Ac3H11_2560 med ABC transporter for L-Histidine, ATPase component (characterized) 43% 73% 147.5 CysA aka B2422, component of Sulfate/thiosulfate porter 62% 342.0
sucrose catabolism thuK lo ABC transporter (characterized, see rationale) 40% 94% 239.2 CysA aka B2422, component of Sulfate/thiosulfate porter 62% 342.0
D-mannitol catabolism mtlK lo SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter (characterized) 39% 99% 230.7 CysA aka B2422, component of Sulfate/thiosulfate porter 62% 342.0
D-sorbitol (glucitol) catabolism mtlK lo ABC transporter for D-Sorbitol, ATPase component (characterized) 38% 96% 228.4 CysA aka B2422, component of Sulfate/thiosulfate porter 62% 342.0
D-glucosamine (chitosamine) catabolism SM_b21216 lo ABC transporter for D-Glucosamine, ATPase component (characterized) 39% 85% 223 CysA aka B2422, component of Sulfate/thiosulfate porter 62% 342.0
L-arabinose catabolism xacK lo Xylose/arabinose import ATP-binding protein XacK; EC 7.5.2.13 (characterized, see rationale) 39% 84% 219.2 CysA aka B2422, component of Sulfate/thiosulfate porter 62% 342.0
D-xylose catabolism gtsD lo ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 39% 79% 216.1 CysA aka B2422, component of Sulfate/thiosulfate porter 62% 342.0
D-maltose catabolism malK lo Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 (characterized) 36% 97% 215.7 CysA aka B2422, component of Sulfate/thiosulfate porter 62% 342.0
trehalose catabolism malK lo MsmK aka SMU.882, component of The raffinose/stachyose transporter, MsmEFGK (MalK (3.A.1.1.27) can probably substitute for MsmK; Webb et al., 2008). This system may also transport melibiose, isomaltotriose and sucrose as well as isomaltosaccharides (characterized) 37% 83% 214.9 CysA aka B2422, component of Sulfate/thiosulfate porter 62% 342.0
D-mannose catabolism TT_C0211 lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 40% 77% 213.4 CysA aka B2422, component of Sulfate/thiosulfate porter 62% 342.0
D-maltose catabolism malK_Sm lo MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) 36% 99% 212.2 CysA aka B2422, component of Sulfate/thiosulfate porter 62% 342.0
D-maltose catabolism aglK lo ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 38% 88% 209.1 CysA aka B2422, component of Sulfate/thiosulfate porter 62% 342.0
sucrose catabolism aglK lo ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 38% 88% 209.1 CysA aka B2422, component of Sulfate/thiosulfate porter 62% 342.0
trehalose catabolism aglK lo ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 38% 88% 209.1 CysA aka B2422, component of Sulfate/thiosulfate porter 62% 342.0
xylitol catabolism HSERO_RS17020 lo ABC-type sugar transport system, ATPase component protein (characterized, see rationale) 43% 69% 208.4 CysA aka B2422, component of Sulfate/thiosulfate porter 62% 342.0
lactose catabolism lacK lo ABC transporter for Lactose, ATPase component (characterized) 39% 80% 206.5 CysA aka B2422, component of Sulfate/thiosulfate porter 62% 342.0
L-arabinose catabolism xacJ lo Xylose/arabinose import ATP-binding protein XacJ; EC 7.5.2.13 (characterized, see rationale) 42% 66% 204.9 CysA aka B2422, component of Sulfate/thiosulfate porter 62% 342.0
D-cellobiose catabolism SMc04256 lo ABC transporter for D-Cellobiose and D-Salicin, ATPase component (characterized) 40% 82% 201.8 CysA aka B2422, component of Sulfate/thiosulfate porter 62% 342.0
D-cellobiose catabolism msiK lo MsiK protein, component of The cellobiose/cellotriose (and possibly higher cellooligosaccharides), CebEFGMsiK [MsiK functions to energize several ABC transporters including those for maltose/maltotriose and trehalose] (characterized) 36% 87% 201.4 CysA aka B2422, component of Sulfate/thiosulfate porter 62% 342.0
D-cellobiose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 33% 96% 193.7 CysA aka B2422, component of Sulfate/thiosulfate porter 62% 342.0
D-glucose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 33% 96% 193.7 CysA aka B2422, component of Sulfate/thiosulfate porter 62% 342.0
lactose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 33% 96% 193.7 CysA aka B2422, component of Sulfate/thiosulfate porter 62% 342.0
D-maltose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 33% 96% 193.7 CysA aka B2422, component of Sulfate/thiosulfate porter 62% 342.0
sucrose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 33% 96% 193.7 CysA aka B2422, component of Sulfate/thiosulfate porter 62% 342.0
trehalose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 33% 96% 193.7 CysA aka B2422, component of Sulfate/thiosulfate porter 62% 342.0
glycerol catabolism glpT lo ABC transporter for Glycerol, ATPase component 2 (characterized) 35% 83% 171 CysA aka B2422, component of Sulfate/thiosulfate porter 62% 342.0
L-proline catabolism proV lo Glycine betaine/proline betaine transport system ATP-binding protein ProV (characterized) 36% 67% 169.9 CysA aka B2422, component of Sulfate/thiosulfate porter 62% 342.0
L-proline catabolism opuBA lo BilEA aka OpuBA protein, component of A proline/glycine betaine uptake system. Also reported to be a bile exclusion system that exports oxgall and other bile compounds, BilEA/EB or OpuBA/BB (required for normal virulence) (characterized) 35% 78% 165.2 CysA aka B2422, component of Sulfate/thiosulfate porter 62% 342.0
L-histidine catabolism hutV lo ABC transporter for L-Histidine, ATPase component (characterized) 38% 82% 163.7 CysA aka B2422, component of Sulfate/thiosulfate porter 62% 342.0
D-glucosamine (chitosamine) catabolism AO353_21725 lo ABC transporter for D-Glucosamine, putative ATPase component (characterized) 38% 93% 161.8 CysA aka B2422, component of Sulfate/thiosulfate porter 62% 342.0
glycerol catabolism glpS lo ABC transporter for Glycerol, ATPase component 1 (characterized) 36% 81% 159.5 CysA aka B2422, component of Sulfate/thiosulfate porter 62% 342.0
L-proline catabolism hutV lo HutV aka HISV aka R02702 aka SMC00670, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized) 39% 85% 156.4 CysA aka B2422, component of Sulfate/thiosulfate porter 62% 342.0
L-tryptophan catabolism ecfA2 lo Energy-coupling factor transporter ATP-binding protein EcfA2; Short=ECF transporter A component EcfA2; EC 7.-.-.- (characterized, see rationale) 35% 78% 126.3 CysA aka B2422, component of Sulfate/thiosulfate porter 62% 342.0

Sequence Analysis Tools

View WP_004304861.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MSIQVRNIHKRFGSFIALDDVSLDFPTGELVALLGPSGCGKTTLLRVIAGLESADAGQVL
LDGDDASGTHVRDRQVGFVFQHYALFRHMSVFDNVAFGLRMKPRGQRPTEKQIAGKVHAL
LDLVQLDWLADRFPAQLSGGQRQRIALARALAVEPRVLLLDEPFGALDAKVRKELRRWLR
KLHDELHVTSIFVTHDQEEALEVADRVVLMNQGAVEQIGTPEEVYRRPATPFVYGFLGAV
NLFHGRVDGEGLRVGDARLPQQARGFGEGAEVLAFARPHELDIVPDAGAGEGIAARVSRV
LAFGITARVELDGLNGAQGQHFEVEITRERVDRLGLAEGQAVRLLPSHLSLFESRQAATT
AGAAR

This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory