Align Histidine transport ATP-binding protein HisP (characterized)
to candidate WP_004303338.1 C665_RS06460 ATP-binding cassette domain-containing protein
Query= SwissProt::P02915 (258 letters) >NCBI__GCF_000310185.1:WP_004303338.1 Length = 265 Score = 363 bits (932), Expect = e-105 Identities = 182/256 (71%), Positives = 218/256 (85%), Gaps = 1/256 (0%) Query: 3 SENKLHVIDLHKRYGGHEVLKGVSLQARAGDVISIIGSSGSGKSTFLRCINFLEKPSEGA 62 S ++ V DLHK YG HEVLKGVSL A +GDVISIIGSSGSGKST+LRCINFLE P+ G Sbjct: 11 SVEQVRVEDLHKSYGDHEVLKGVSLTANSGDVISIIGSSGSGKSTWLRCINFLECPTAGR 70 Query: 63 IIVNGQNINLVRDKDGQLKVADKNQLRLLRTRLTMVFQHFNLWSHMTVLENVMEAPIQVL 122 I+V G+ + LVRD+ G+L V D +QL+ +RTRL+MVFQHFNLWSHMTVLENV+EAP+ VL Sbjct: 71 ILVGGKEVELVRDRKGELVVKDAHQLQQIRTRLSMVFQHFNLWSHMTVLENVVEAPVHVL 130 Query: 123 GLSKHDARERALKYLAKVGIDERAQGKYPVHLSGGQQQRVSIARALAMEPDVLLFDEPTS 182 GLSK ARERA +YL +VG+ + + YP H+SGGQQQRV+IARALAMEP VLLFDEPTS Sbjct: 131 GLSKAAARERAERYLERVGV-WKFRDAYPAHMSGGQQQRVAIARALAMEPAVLLFDEPTS 189 Query: 183 ALDPELVGEVLRIMQQLAEEGKTMVVVTHEMGFARHVSSHVIFLHQGKIEEEGDPEQVFG 242 ALDPELVGEVL++M+ LAEEG+TM+VVTHEMGFAR VS+HVIF+HQG++EEEGDP++V Sbjct: 190 ALDPELVGEVLKVMRSLAEEGRTMMVVTHEMGFAREVSNHVIFVHQGRVEEEGDPKEVLV 249 Query: 243 NPQSPRLQQFLKGSLK 258 P+S RLQQFL G+LK Sbjct: 250 RPRSERLQQFLSGNLK 265 Lambda K H 0.319 0.136 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 256 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 265 Length adjustment: 25 Effective length of query: 233 Effective length of database: 240 Effective search space: 55920 Effective search space used: 55920 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory