Align Alpha-ketoglutarate permease (characterized)
to candidate WP_017597434.1 D471_RS0103990 MFS transporter
Query= SwissProt::P0AEX3 (432 letters) >NCBI__GCF_000341125.1:WP_017597434.1 Length = 433 Score = 193 bits (491), Expect = 8e-54 Identities = 134/420 (31%), Positives = 208/420 (49%), Gaps = 19/420 (4%) Query: 13 TSSDTRRRIWAIVGASSGNLVEWFDFYVYSFCS-LYFAHIFFPSG-NTTTQLLQTAGVFA 70 TS R A V A G +EWFDFYVY+ + L F +FFP + L+ + FA Sbjct: 5 TSPTAARPARAAVAAFVGTTIEWFDFYVYATAAGLVFGTLFFPGDIDPMVGLMASFATFA 64 Query: 71 AGFLMRPIGGWLFGRIADKHGRKKSMLLSVCMMCFGSLVIACLPGYETIGTWAPALLLLA 130 GF RP+GG +FG D+ GRK +++ ++ MM + + LP Y +G AP LL++ Sbjct: 65 VGFFARPLGGVVFGHFGDRLGRKSALVTTLLMMGVATFCVGLLPTYAQVGFVAPLLLVVL 124 Query: 131 RLFQGLSVGGEYGTSATYMSEVAVEGRKGFYASFQYVTLIGGQLLALLVVVVLQHTMEDA 190 R QG++VGGE+G + E A E RK FY SF + G LLA ++ + Sbjct: 125 RFVQGIAVGGEWGGAVLMAVESAPEERKTFYGSFAQLGNPAGALLATGSFGLIT-AWDSD 183 Query: 191 ALREWGWRIPFALGAVLAVVALWLRRQLDET----SQQETRALKEAG-----SLKGLWRN 241 L WGWR+PF +L +V L +R +++E+ + +E RA + G +L+ WR Sbjct: 184 LLYTWGWRLPFLASCLLVLVGLVVRLKVEESPVFEAARENRAAEPEGPPLRETLRTSWRA 243 Query: 242 RRAFIMVLGFTAAGSLCFYTFTTYMQKYLVNTAGMHANVASGIMTAALFVFMLIQPLIGA 301 I VL G +Y TT++Q Y V AG+ + +T A FV + Sbjct: 244 VLLGIGVLPVAVGG---YYVVTTFLQAYGVTEAGISEQLILSGLTLAAFVELFATLATAW 300 Query: 302 LSDKIGRRTSMLCFGSLAAIFTVPILSALQNVSSPYAAFGLVMCALLIVSFYTSISGILK 361 L D+ G + + A+ +P L+ S+ L + + + + Y I+ +L Sbjct: 301 LGDRFGTARIVTVGLAAVAVLALPQFLVLETGSAVLIVLMLCLMRVAMAAVYGPIARVL- 359 Query: 362 AEMFPAQVRALGVGLSYAVANAIFGGSAEYVALSLKSIGMETAFFWYVTLMAVVAFLVSL 421 A+M+P +VR G+ +SY VA A+FGG + +L ++ T V ++ VV LVS+ Sbjct: 360 AQMYPPRVRYTGISVSYQVAGALFGGLSPLACTALFAL---TGSILSVAVLLVVMALVSI 416 Lambda K H 0.328 0.138 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 458 Number of extensions: 28 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 432 Length of database: 433 Length adjustment: 32 Effective length of query: 400 Effective length of database: 401 Effective search space: 160400 Effective search space used: 160400 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory