Align Tricarboxylate transport protein TctB (characterized)
to candidate WP_152486211.1 D471_RS32895 tripartite tricarboxylate transporter TctB family protein
Query= reanno::Dino:3609739 (162 letters) >NCBI__GCF_000341125.1:WP_152486211.1 Length = 236 Score = 41.6 bits (96), Expect = 9e-09 Identities = 29/88 (32%), Positives = 44/88 (50%), Gaps = 3/88 (3%) Query: 72 AGDIDYRRLGDYKIGQAALLLGLMVGYALLLRPAGFLVSTTSFLILGSVILGERNWPVMI 131 AG RL D ++ + AL +G ++ Y L P GF++ST +L +V LG R Sbjct: 149 AGTAALGRLKDPRL-EVALFVGALIVYVALFEPLGFILSTALYLGSMTVYLGYRRHVATA 207 Query: 132 GVAVVATGAIWYLVQEVLGIFL--RPLP 157 VA+ ++ + E LG+ L PLP Sbjct: 208 AVAIGLPLTLYLAMSEGLGVVLPSGPLP 235 Lambda K H 0.329 0.147 0.467 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 92 Number of extensions: 4 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 162 Length of database: 236 Length adjustment: 20 Effective length of query: 142 Effective length of database: 216 Effective search space: 30672 Effective search space used: 30672 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 44 (21.6 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory