Align Glutarate-semialdehyde dehydrogenase (EC 1.2.1.20) (characterized)
to candidate WP_017601549.1 D471_RS0127260 aldehyde dehydrogenase family protein
Query= reanno::pseudo13_GW456_L13:PfGW456L13_495 (480 letters) >NCBI__GCF_000341125.1:WP_017601549.1 Length = 458 Score = 310 bits (793), Expect = 9e-89 Identities = 177/448 (39%), Positives = 255/448 (56%), Gaps = 8/448 (1%) Query: 29 KVNNPATGEILGTVPKMGAAETRRAIEAADKALPAWRALTAKERATKLRRWYELIIENQD 88 +V +PAT ++ VP G E A+E A A PAWRA+ +RA LR I ++++ Sbjct: 9 RVVDPATEAVIAEVPLAGEKEVDAAVERARAAAPAWRAMAPGDRARLLRAVAARIDQHRE 68 Query: 89 DLARLMTLEQGKPLAEAKGEIVYAASFIEWFAEEAKRIYGDVIPGHQPDKRLIVIKQPIG 148 +LAR G P+ +A+ E A E+FA +R G IP P + +P+G Sbjct: 69 ELARTEVRNAGHPVEQARWEAGNARDVFEYFAAAPERATGRQIP--VPGGWSVTFAEPLG 126 Query: 149 VTAAITPWNFPAAMITRKAGPALAAGCTMVLKPASQTPFSAFALAELAQRAGIPAGVFSV 208 V I PWNFP +++ A PALAAG T+V+KP+ TP +A +AELA AG+P GVF V Sbjct: 127 VVGVIVPWNFPMPVLSWGAAPALAAGNTVVVKPSELTPLTALRIAELALEAGLPEGVFQV 186 Query: 209 VSGSAGDIGSELTSNPIVRKLSFTGSTEIGRQLMSECAKDIKKVSLELGGNAPFIVFDDA 268 V G+ G L +P V K+ FTGST +GR++M+ A+D +V+LELGG + +VF DA Sbjct: 187 VPGTGPVAGERLVRHPGVDKVVFTGSTAVGRRIMTAAAEDFTRVTLELGGKSANVVFADA 246 Query: 269 DLDKAVEGAIISKYRNNGQTCVCANRLYIQDGVYDAFAEKLKVAVAKLKIGNGLEAGTTT 328 DL++A GA + N GQ C +R+ +Q V+D F E L+ AV + +G+ + T Sbjct: 247 DLERAAAGAPGGAFDNAGQDCCARSRVLVQRSVFDRFLELLEPAVTGIAVGDPSDPATAM 306 Query: 329 GPLIDEKAVAKVQEHIADALSKGATVLAGGKPMEGN--FFEPTILTNVPNNAAVAKEETF 386 GPLI A ++ +A + + A V G EG +F PT+LT NA V +EE F Sbjct: 307 GPLIS----AAQRDRVASYVPEDAPVAFRGSAPEGPGFWFPPTVLTPTDPNARVLREEVF 362 Query: 387 GPLAPLFRFKDEADVIAMSNDTEFGLASYFYARDLGRVFRVAEALEYGMVGVNTGLISNE 446 GP+ + F+DEA+ +A++NDTE+GLA + RD+GR RVA + G + VN+ Sbjct: 363 GPVMCVVPFEDEAEAVALANDTEYGLAGSVWTRDVGRALRVARGVRAGNLSVNSHSAVRY 422 Query: 447 VAPFGGIKASGLGREGSKYGIEDYLEIK 474 PFGG+ SG+GRE +E + E K Sbjct: 423 WTPFGGMGHSGIGRELGPDALEAFTETK 450 Lambda K H 0.317 0.135 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 570 Number of extensions: 24 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 480 Length of database: 458 Length adjustment: 33 Effective length of query: 447 Effective length of database: 425 Effective search space: 189975 Effective search space used: 189975 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory