Align Crotonyl-CoA hydratase; EC 4.2.1.150 (characterized)
to candidate WP_017600842.1 D471_RS0123255 enoyl-CoA hydratase-related protein
Query= SwissProt::Q0AVM1 (260 letters) >NCBI__GCF_000341125.1:WP_017600842.1 Length = 155 Score = 108 bits (270), Expect = 6e-29 Identities = 66/157 (42%), Positives = 89/157 (56%), Gaps = 7/157 (4%) Query: 99 PVIAAVNGFALGGGCELAMCCDFRIAASNAKFGQPEVGLGITPGFGGTQRLPRLVGPGMA 158 P +AAV+GFALGGG EL+ CD R+A A F QPE GLGI G G RL LVG +A Sbjct: 4 PTVAAVDGFALGGGAELSYACDIRLATPAAVFAQPEPGLGIIAGAGACWRLRELVGASVA 63 Query: 159 KQLLYTADVINADEAFRIGLVNKVVQPEELLPEVKKIAGRILSKGQLAVRLSKAAANEGM 218 KQ+L ++A+ A R GLV ++V EEL + R+ + LA+R++K M Sbjct: 64 KQVLLGGFRLDAEAALRHGLVAEIVPAEELRGRAHALLDRMAASSALALRMTK------M 117 Query: 219 QTDIDRAMSIEAD-AFGLCFATQDQKEGMTAFLEKRK 254 D D A I D + F + D+ + MT FLE++K Sbjct: 118 VLDADGAHPIADDLTQAVLFESADKHDRMTRFLERKK 154 Lambda K H 0.319 0.136 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 92 Number of extensions: 5 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 155 Length adjustment: 21 Effective length of query: 239 Effective length of database: 134 Effective search space: 32026 Effective search space used: 32026 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory