Align Crotonyl-CoA hydratase; EC 4.2.1.150 (characterized)
to candidate WP_017601368.1 D471_RS0126255 1,4-dihydroxy-2-naphthoyl-CoA synthase
Query= SwissProt::Q0AVM1 (260 letters) >NCBI__GCF_000341125.1:WP_017601368.1 Length = 279 Score = 140 bits (354), Expect = 2e-38 Identities = 92/261 (35%), Positives = 134/261 (51%), Gaps = 7/261 (2%) Query: 3 YENIILEKEEKLAVLYINRPKAMNALNKDTLLEIKDAVTAVNDDPAVELLIITGSGDKSF 62 Y +II E E +A + INRP+ NA TL E++DA DD V ++I TG+GD++F Sbjct: 13 YSDIIYETAEGIAKITINRPEVHNAFRPQTLFELQDAFNVARDDSEVGVIIFTGAGDQAF 72 Query: 63 VAGADIAFM-----QNLSAMEAREFGALGQKVFRL-IEAMEKPVIAAVNGFALGGGCELA 116 +G D A+ + G L ++ I + KPVI V G+++GGG L Sbjct: 73 CSGGDQKIRGEDGYMGDDAVAKQGIGRLNVLDLQVQIRRLPKPVICMVAGWSIGGGNVLQ 132 Query: 117 MCCDFRIAASNAKFGQPEVGLGITPGFGGTQRLPRLVGPGMAKQLLYTADVINADEAFRI 176 +CCD IAA NAKFGQ +G G G+ L + VG A+++ Y +A EA + Sbjct: 133 VCCDLTIAADNAKFGQTGPKVGSFDGGYGSWLLAQTVGLKKAREIWYLCRQYSAQEALDM 192 Query: 177 GLVNKVVQPEELLPEVKKIAGRILSKGQLAVRLSKAAANEGMQTDIDRAMSIEADAFGLC 236 G+VN VV +L E + A +L K LA+R+ K A N + DA L Sbjct: 193 GMVNTVVPLADLEKETVQWAREMLDKSPLALRMVKGAIN-AVSDGAAGMQQFAGDATMLY 251 Query: 237 FATQDQKEGMTAFLEKRKANF 257 + +++ +EG AF EKR+ F Sbjct: 252 YMSEEAQEGRDAFKEKRRPEF 272 Lambda K H 0.319 0.136 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 175 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 279 Length adjustment: 25 Effective length of query: 235 Effective length of database: 254 Effective search space: 59690 Effective search space used: 59690 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory