Align Galactitol 2-dehydrogenase; GDH; Sorbitol dehydrogenase; SorbD; EC 1.1.1.16; EC 1.1.1.- (characterized)
to candidate WP_020563277.1 A3OW_RS0109870 3-oxoacyl-ACP reductase FabG
Query= SwissProt::A9CES4 (256 letters) >NCBI__GCF_000372865.1:WP_020563277.1 Length = 242 Score = 130 bits (327), Expect = 3e-35 Identities = 82/250 (32%), Positives = 130/250 (52%), Gaps = 12/250 (4%) Query: 6 KVALITGAARGIGLGFAQAFAAEGAKVIIADIDIARATTSAAAIGPAAKAVKLDVTDLAQ 65 +VAL+TGA+RGIG A+ A +G V+ A +A +G K +KLDV D Sbjct: 4 QVALVTGASRGIGRAIAERLAGDGFFVVGTATTDNGAQAISAYLGENGKGLKLDVADAES 63 Query: 66 IDAVVKAVDEEFGGIDILVNNAAIFDMAPINGITEESYERVFDINLKGPMFMMKAVSNVM 125 + V K V++EFG +LVNNA I + + +E ++ + NL M KAV M Sbjct: 64 VAEVTKTVNDEFGTPVVLVNNAGITRDNLLMRMKDEEWDSIISTNLTSVYRMSKAVLRGM 123 Query: 126 IARARGGKIINMASQAGRRGEALVTLYCASKAAIISATQSAALALVKHGINVNAIAPGVV 185 + +A+ G+IIN++S G G A Y A+KA I+ T+S A + I VN +APG + Sbjct: 124 M-KAKTGRIINISSVVGATGNAGQANYAAAKAGIVGFTKSMAKEVGSRNITVNTVAPGFI 182 Query: 186 DGEHWEVVDAHFAKWEGLKPGEKKAAVAKSVPIGRFATPDDIKGLAVFLASADSDYILAQ 245 D + + + + + ++ +P+GR P+++ FLAS + YI + Sbjct: 183 DTDMTKELS-----------DDVRQSLLSVIPLGRLGEPEEVAHAVSFLASPHAGYITGE 231 Query: 246 TYNVDGGNWM 255 T +V+GG +M Sbjct: 232 TLHVNGGMYM 241 Lambda K H 0.319 0.133 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 126 Number of extensions: 5 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 256 Length of database: 242 Length adjustment: 24 Effective length of query: 232 Effective length of database: 218 Effective search space: 50576 Effective search space used: 50576 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory