Align SDR family oxidoreductase (characterized, see rationale)
to candidate WP_020563736.1 A3OW_RS0112260 SDR family oxidoreductase
Query= uniprot:A0A4P7ABK7 (254 letters) >NCBI__GCF_000372865.1:WP_020563736.1 Length = 254 Score = 135 bits (339), Expect = 1e-36 Identities = 90/252 (35%), Positives = 133/252 (52%), Gaps = 20/252 (7%) Query: 11 KTVLITAAAQGIGRASTELFAREGARVIATDISKTHLEELA-SIAGVETHLLDVTDD--- 66 K +T AA GIGRA+ FAREGA V DIS+ +E A I + L VT D Sbjct: 8 KVAFVTGAANGIGRAAALAFAREGACVTVVDISEQGNQETACQIEDIGGRALAVTCDVTR 67 Query: 67 -----DAIKALVAKVGTVDVLFNCAGYVAAGNI--LECDDKAWDFSFNLNAKAMFHTIRA 119 A+ V G +D FN AG + E D+ WD ++ +++F ++ Sbjct: 68 LEDVKSALDQTVGTFGRLDAAFNNAGVEQKQLVPLAELDEAEWDRIMTIDLRSVFLCMKY 127 Query: 120 VLPGMLAKKAGSIVNIASAASSVKGVANRFAYGASKAAVVGLTKSVAADFVSQGIRCNAI 179 +P ML G+IVN +S A + G+ AY A+K V+GLT++ A D+ + +R NA+ Sbjct: 128 EIPLMLKHGGGAIVNTSSGAGII-GIKGNPAYTAAKHGVIGLTRAAALDYAAANVRINAV 186 Query: 180 CPGTIESPSLNQRISTQAKETGKSEDEVRAAFVARQPMGRIGKAEEVAALALYLASDESN 239 CPG I++P + A+ TG + E RA ++ +P+GR+G+ EE+A L+L SD Sbjct: 187 CPGYIDTPMM-------ARFTGGTA-EGRARVISEEPIGRMGQPEEIANAVLWLCSDAVP 238 Query: 240 FTTGSIHMIDGG 251 F G +IDGG Sbjct: 239 FIIGHALVIDGG 250 Lambda K H 0.316 0.129 0.359 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 135 Number of extensions: 7 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 254 Length adjustment: 24 Effective length of query: 230 Effective length of database: 230 Effective search space: 52900 Effective search space used: 52900 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory