GapMind for catabolism of small carbon sources

 

Protein WP_018123488.1 in Desulfovibrio oxyclinae DSM 11498

Annotation: NCBI__GCF_000375485.1:WP_018123488.1

Length: 311 amino acids

Source: GCF_000375485.1 in NCBI

Candidate for 19 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
D-cellobiose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 35% 95% 203 WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter 36% 207.6
D-galactose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 35% 95% 203 WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter 36% 207.6
D-glucose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 35% 95% 203 WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter 36% 207.6
lactose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 35% 95% 203 WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter 36% 207.6
D-maltose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 35% 95% 203 WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter 36% 207.6
D-mannose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 35% 95% 203 WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter 36% 207.6
sucrose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 35% 95% 203 WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter 36% 207.6
trehalose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 35% 95% 203 WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter 36% 207.6
putrescine catabolism potA lo spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 (characterized) 43% 63% 193.4 WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter 36% 207.6
L-arabinose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 37% 67% 185.7 WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter 36% 207.6
D-fructose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 37% 67% 185.7 WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter 36% 207.6
sucrose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 37% 67% 185.7 WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter 36% 207.6
D-xylose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 37% 67% 185.7 WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter 36% 207.6
D-maltose catabolism malK1 lo MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized) 39% 66% 182.6 WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter 36% 207.6
trehalose catabolism thuK lo MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized) 39% 66% 182.6 WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter 36% 207.6
xylitol catabolism Dshi_0546 lo ABC transporter for Xylitol, ATPase component (characterized) 33% 94% 173.3 WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter 36% 207.6
D-sorbitol (glucitol) catabolism mtlK lo ABC transporter for D-Sorbitol, ATPase component (characterized) 34% 93% 164.5 WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter 36% 207.6
glycerol catabolism glpT lo GlpT, component of Glycerol uptake porter, GlpSTPQV (characterized) 32% 75% 139 WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter 36% 207.6
glycerol catabolism glpS lo GlpS, component of Glycerol uptake porter, GlpSTPQV (characterized) 32% 78% 134.8 WtpC, component of Tungsten (KM=20pM)/molybdate (KM=10nM) porter 36% 207.6

Sequence Analysis Tools

View WP_018123488.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MFFGVEGLTKTYEAAPVLEDVTFGMEKGEMVSIIGPSGAGKTTLLKLVAGLDRPTSGRVI
FQNEPSRENPVIMVFQDYVLFPSMTVCENVAFGLRARRLSGDEVRRRVMEVLDYFGLVSK
ADAYPEHLSGGQRQRVAIARGLVVNPMMLLLDEPFANLDRNLKLQTAEFIRETQRNFGVT
TLSVTHDLEEAFVMSDRIGLVMDGRLVQFGEARDVYFNPVHEDAARFLGPLNVLEGEVLT
LMGCEGTQRRAVRPESLLLHPREDGAGRVLCADFAGHFTKYLVEVGDTVITVYGTDSALR
HGDRVAIEIIE

This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory