GapMind for catabolism of small carbon sources

 

Protein WP_018125624.1 in Desulfovibrio oxyclinae DSM 11498

Annotation: NCBI__GCF_000375485.1:WP_018125624.1

Length: 362 amino acids

Source: GCF_000375485.1 in NCBI

Candidate for 45 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
glycerol catabolism glpT hi GlpT, component of Glycerol uptake porter, GlpSTPQV (characterized) 58% 98% 413.7 MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins 41% 231.9
D-maltose catabolism malK1 med MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized) 41% 95% 231.9 GlpT, component of Glycerol uptake porter, GlpSTPQV 58% 413.7
trehalose catabolism thuK med MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized) 41% 95% 231.9 GlpT, component of Glycerol uptake porter, GlpSTPQV 58% 413.7
D-sorbitol (glucitol) catabolism mtlK med ABC transporter for D-Sorbitol, ATPase component (characterized) 44% 72% 208.8 GlpT, component of Glycerol uptake porter, GlpSTPQV 58% 413.7
N-acetyl-D-glucosamine catabolism SMc02869 med N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 41% 73% 190.3 GlpT, component of Glycerol uptake porter, GlpSTPQV 58% 413.7
D-glucosamine (chitosamine) catabolism SMc02869 med N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 41% 73% 190.3 GlpT, component of Glycerol uptake porter, GlpSTPQV 58% 413.7
D-maltose catabolism thuK lo Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 (characterized) 39% 93% 223.4 GlpT, component of Glycerol uptake porter, GlpSTPQV 58% 413.7
D-maltose catabolism malK_Sm lo MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) 38% 95% 217.2 GlpT, component of Glycerol uptake porter, GlpSTPQV 58% 413.7
trehalose catabolism malK lo MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) 38% 95% 217.2 GlpT, component of Glycerol uptake porter, GlpSTPQV 58% 413.7
D-maltose catabolism malK_Aa lo ABC-type maltose transporter (EC 7.5.2.1) (characterized) 37% 94% 216.5 GlpT, component of Glycerol uptake porter, GlpSTPQV 58% 413.7
D-cellobiose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 37% 89% 215.3 GlpT, component of Glycerol uptake porter, GlpSTPQV 58% 413.7
D-glucose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 37% 89% 215.3 GlpT, component of Glycerol uptake porter, GlpSTPQV 58% 413.7
lactose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 37% 89% 215.3 GlpT, component of Glycerol uptake porter, GlpSTPQV 58% 413.7
D-maltose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 37% 89% 215.3 GlpT, component of Glycerol uptake porter, GlpSTPQV 58% 413.7
D-mannitol catabolism mtlK lo SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter (characterized) 40% 92% 215.3 GlpT, component of Glycerol uptake porter, GlpSTPQV 58% 413.7
sucrose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 37% 89% 215.3 GlpT, component of Glycerol uptake porter, GlpSTPQV 58% 413.7
trehalose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 37% 89% 215.3 GlpT, component of Glycerol uptake porter, GlpSTPQV 58% 413.7
L-fucose catabolism SM_b21106 lo ABC transporter for L-Fucose, ATPase component (characterized) 39% 90% 214.5 GlpT, component of Glycerol uptake porter, GlpSTPQV 58% 413.7
D-galactose catabolism PfGW456L13_1897 lo ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) 37% 92% 214.5 GlpT, component of Glycerol uptake porter, GlpSTPQV 58% 413.7
D-maltose catabolism malK lo Maltose-transporting ATPase (EC 3.6.3.19) (characterized) 36% 95% 211.8 GlpT, component of Glycerol uptake porter, GlpSTPQV 58% 413.7
D-cellobiose catabolism msiK lo MsiK protein, component of The cellobiose/cellotriose (and possibly higher cellooligosaccharides), CebEFGMsiK [MsiK functions to energize several ABC transporters including those for maltose/maltotriose and trehalose] (characterized) 37% 85% 209.9 GlpT, component of Glycerol uptake porter, GlpSTPQV 58% 413.7
D-cellobiose catabolism SMc04256 lo ABC transporter for D-Cellobiose and D-Salicin, ATPase component (characterized) 37% 88% 208.4 GlpT, component of Glycerol uptake porter, GlpSTPQV 58% 413.7
D-xylose catabolism gtsD lo ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 35% 92% 208 GlpT, component of Glycerol uptake porter, GlpSTPQV 58% 413.7
xylitol catabolism HSERO_RS17020 lo ABC-type sugar transport system, ATPase component protein (characterized, see rationale) 37% 83% 207.6 GlpT, component of Glycerol uptake porter, GlpSTPQV 58% 413.7
D-mannose catabolism TT_C0211 lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 35% 90% 206.1 GlpT, component of Glycerol uptake porter, GlpSTPQV 58% 413.7
sucrose catabolism thuK lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 35% 90% 206.1 GlpT, component of Glycerol uptake porter, GlpSTPQV 58% 413.7
D-maltose catabolism malK_Bb lo ABC-type maltose transport, ATP binding protein (characterized, see rationale) 38% 84% 204.5 GlpT, component of Glycerol uptake porter, GlpSTPQV 58% 413.7
L-arabinose catabolism xacK lo Xylose/arabinose import ATP-binding protein XacK; EC 7.5.2.13 (characterized, see rationale) 35% 94% 204.1 GlpT, component of Glycerol uptake porter, GlpSTPQV 58% 413.7
D-glucosamine (chitosamine) catabolism SM_b21216 lo ABC transporter for D-Glucosamine, ATPase component (characterized) 36% 85% 203 GlpT, component of Glycerol uptake porter, GlpSTPQV 58% 413.7
D-maltose catabolism musK lo ABC-type maltose transporter (EC 7.5.2.1) (characterized) 37% 83% 199.9 GlpT, component of Glycerol uptake porter, GlpSTPQV 58% 413.7
D-maltose catabolism aglK lo ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 38% 79% 194.1 GlpT, component of Glycerol uptake porter, GlpSTPQV 58% 413.7
sucrose catabolism aglK lo ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 38% 79% 194.1 GlpT, component of Glycerol uptake porter, GlpSTPQV 58% 413.7
trehalose catabolism aglK lo ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 38% 79% 194.1 GlpT, component of Glycerol uptake porter, GlpSTPQV 58% 413.7
xylitol catabolism Dshi_0546 lo ABC transporter for Xylitol, ATPase component (characterized) 37% 92% 194.1 GlpT, component of Glycerol uptake porter, GlpSTPQV 58% 413.7
lactose catabolism lacK lo LacK, component of Lactose porter (characterized) 36% 87% 193.7 GlpT, component of Glycerol uptake porter, GlpSTPQV 58% 413.7
D-cellobiose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 34% 96% 184.5 GlpT, component of Glycerol uptake porter, GlpSTPQV 58% 413.7
D-glucose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 34% 96% 184.5 GlpT, component of Glycerol uptake porter, GlpSTPQV 58% 413.7
lactose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 34% 96% 184.5 GlpT, component of Glycerol uptake porter, GlpSTPQV 58% 413.7
D-maltose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 34% 96% 184.5 GlpT, component of Glycerol uptake porter, GlpSTPQV 58% 413.7
sucrose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 34% 96% 184.5 GlpT, component of Glycerol uptake porter, GlpSTPQV 58% 413.7
trehalose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 34% 96% 184.5 GlpT, component of Glycerol uptake porter, GlpSTPQV 58% 413.7
L-arabinose catabolism xacJ lo Xylose/arabinose import ATP-binding protein XacJ; EC 7.5.2.13 (characterized, see rationale) 32% 94% 179.1 GlpT, component of Glycerol uptake porter, GlpSTPQV 58% 413.7
trehalose catabolism treV lo TreV, component of Trehalose porter (characterized) 35% 86% 179.1 GlpT, component of Glycerol uptake porter, GlpSTPQV 58% 413.7
putrescine catabolism potA lo PotG aka B0855, component of Putrescine porter (characterized) 32% 86% 170.2 GlpT, component of Glycerol uptake porter, GlpSTPQV 58% 413.7
glycerol catabolism glpS lo ABC transporter for Glycerol, ATPase component 1 (characterized) 32% 90% 146.7 GlpT, component of Glycerol uptake porter, GlpSTPQV 58% 413.7

Sequence Analysis Tools

View WP_018125624.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MARIELDELAHSYMANPKGPDDYALKRIHTTWDDGGAYALLGPSGCGKTTMLNIISGLLV
PSHGKVLYDGKDVTKLPPEQRNIAQVFQFPVLYDTMTVYENLAFPLKNRKIPKDQVNKRV
HEIADSLDLTADLNKRAAGLSADAKQKISLGRGLVRSDVAAILFDEPLTVIDPHLKWQLR
RKLKEIHKRFEHTLIYVTHDQVEAMTFADKIVVMYEGELVQIGTPEELFEHPEHTFVGYF
IGSPGMNLVECSVADGIAKAAGLEIPVPGIGTRRAAEASGTSKVELGIRPMYIDIRGKDA
EGLEARITNVEDQGSAKIVTLALGDATFKARVSEDQELPADHCKVFLPPEKIKIFIDGRL
AK

This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory