Protein WP_018125625.1 in Desulfovibrio oxyclinae DSM 11498
Annotation: NCBI__GCF_000375485.1:WP_018125625.1
Length: 360 amino acids
Source: GCF_000375485.1 in NCBI
Candidate for 40 steps in catabolism of small carbon sources
Pathway | Step | Score | Similar to | Id. | Cov. | Bits | Other hit | Other id. | Other bits |
glycerol catabolism | glpS | hi | ABC transporter for Glycerol, ATPase component 1 (characterized) | 53% | 98% | 328.6 | ABC transporter for D-Galactose and D-Glucose, ATPase component | 36% | 217.6 |
D-cellobiose catabolism | gtsD | lo | ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) | 36% | 94% | 217.6 | ABC transporter for Glycerol, ATPase component 1 | 53% | 328.6 |
D-galactose catabolism | PfGW456L13_1897 | lo | ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) | 36% | 94% | 217.6 | ABC transporter for Glycerol, ATPase component 1 | 53% | 328.6 |
D-glucose catabolism | gtsD | lo | ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) | 36% | 94% | 217.6 | ABC transporter for Glycerol, ATPase component 1 | 53% | 328.6 |
lactose catabolism | gtsD | lo | ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) | 36% | 94% | 217.6 | ABC transporter for Glycerol, ATPase component 1 | 53% | 328.6 |
D-maltose catabolism | gtsD | lo | ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) | 36% | 94% | 217.6 | ABC transporter for Glycerol, ATPase component 1 | 53% | 328.6 |
sucrose catabolism | gtsD | lo | ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) | 36% | 94% | 217.6 | ABC transporter for Glycerol, ATPase component 1 | 53% | 328.6 |
trehalose catabolism | gtsD | lo | ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) | 36% | 94% | 217.6 | ABC transporter for Glycerol, ATPase component 1 | 53% | 328.6 |
D-xylose catabolism | gtsD | lo | ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) | 36% | 92% | 213.4 | ABC transporter for Glycerol, ATPase component 1 | 53% | 328.6 |
D-maltose catabolism | thuK | lo | Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 (characterized) | 37% | 98% | 206.1 | ABC transporter for Glycerol, ATPase component 1 | 53% | 328.6 |
D-mannitol catabolism | mtlK | lo | SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter (characterized) | 35% | 100% | 206.1 | ABC transporter for Glycerol, ATPase component 1 | 53% | 328.6 |
trehalose catabolism | thuK | lo | Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 (characterized) | 37% | 98% | 206.1 | ABC transporter for Glycerol, ATPase component 1 | 53% | 328.6 |
sucrose catabolism | thuK | lo | ABC transporter (characterized, see rationale) | 35% | 93% | 204.1 | ABC transporter for Glycerol, ATPase component 1 | 53% | 328.6 |
D-maltose catabolism | malK1 | lo | MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized) | 36% | 97% | 203.8 | ABC transporter for Glycerol, ATPase component 1 | 53% | 328.6 |
D-glucosamine (chitosamine) catabolism | SM_b21216 | lo | ABC transporter for D-Glucosamine, ATPase component (characterized) | 36% | 99% | 200.7 | ABC transporter for Glycerol, ATPase component 1 | 53% | 328.6 |
N-acetyl-D-glucosamine catabolism | SMc02869 | lo | N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) | 36% | 99% | 198.4 | ABC transporter for Glycerol, ATPase component 1 | 53% | 328.6 |
D-glucosamine (chitosamine) catabolism | SMc02869 | lo | N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) | 36% | 99% | 198.4 | ABC transporter for Glycerol, ATPase component 1 | 53% | 328.6 |
D-maltose catabolism | aglK | lo | ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) | 34% | 98% | 197.6 | ABC transporter for Glycerol, ATPase component 1 | 53% | 328.6 |
sucrose catabolism | aglK | lo | ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) | 34% | 98% | 197.6 | ABC transporter for Glycerol, ATPase component 1 | 53% | 328.6 |
trehalose catabolism | aglK | lo | ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) | 34% | 98% | 197.6 | ABC transporter for Glycerol, ATPase component 1 | 53% | 328.6 |
D-maltose catabolism | malK_Aa | lo | ABC-type maltose transporter (EC 7.5.2.1) (characterized) | 35% | 91% | 193.7 | ABC transporter for Glycerol, ATPase component 1 | 53% | 328.6 |
D-sorbitol (glucitol) catabolism | mtlK | lo | MtlK, component of The polyol (mannitol, glucitol (sorbitol), arabitol (arabinitol; lyxitol)) uptake porter, MtlEFGK (characterized) | 34% | 99% | 193.7 | ABC transporter for Glycerol, ATPase component 1 | 53% | 328.6 |
lactose catabolism | lacK | lo | ABC transporter for Lactose, ATPase component (characterized) | 34% | 99% | 189.1 | ABC transporter for Glycerol, ATPase component 1 | 53% | 328.6 |
D-maltose catabolism | malK | lo | Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 (characterized) | 33% | 96% | 189.1 | ABC transporter for Glycerol, ATPase component 1 | 53% | 328.6 |
trehalose catabolism | treV | lo | TreV, component of Trehalose porter (characterized) | 36% | 95% | 187.6 | ABC transporter for Glycerol, ATPase component 1 | 53% | 328.6 |
L-arabinose catabolism | xacK | lo | Xylose/arabinose import ATP-binding protein XacK; EC 7.5.2.13 (characterized, see rationale) | 34% | 95% | 186.8 | ABC transporter for Glycerol, ATPase component 1 | 53% | 328.6 |
xylitol catabolism | HSERO_RS17020 | lo | ABC-type sugar transport system, ATPase component protein (characterized, see rationale) | 34% | 88% | 184.9 | ABC transporter for Glycerol, ATPase component 1 | 53% | 328.6 |
D-maltose catabolism | musK | lo | ABC-type maltose transporter (EC 7.5.2.1) (characterized) | 35% | 90% | 184.1 | ABC transporter for Glycerol, ATPase component 1 | 53% | 328.6 |
D-cellobiose catabolism | SMc04256 | lo | ABC transporter for D-Cellobiose and D-Salicin, ATPase component (characterized) | 33% | 99% | 183.3 | ABC transporter for Glycerol, ATPase component 1 | 53% | 328.6 |
D-maltose catabolism | malK_Bb | lo | ABC-type maltose transport, ATP binding protein (characterized, see rationale) | 34% | 86% | 177.2 | ABC transporter for Glycerol, ATPase component 1 | 53% | 328.6 |
L-arabinose catabolism | xacJ | lo | Xylose/arabinose import ATP-binding protein XacJ; EC 7.5.2.13 (characterized, see rationale) | 32% | 96% | 176.8 | ABC transporter for Glycerol, ATPase component 1 | 53% | 328.6 |
D-cellobiose catabolism | aglK' | lo | Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) | 33% | 96% | 175.3 | ABC transporter for Glycerol, ATPase component 1 | 53% | 328.6 |
D-cellobiose catabolism | msiK | lo | MsiK protein, component of The cellobiose/cellotriose (and possibly higher cellooligosaccharides), CebEFGMsiK [MsiK functions to energize several ABC transporters including those for maltose/maltotriose and trehalose] (characterized) | 33% | 95% | 175.3 | ABC transporter for Glycerol, ATPase component 1 | 53% | 328.6 |
D-glucose catabolism | aglK' | lo | Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) | 33% | 96% | 175.3 | ABC transporter for Glycerol, ATPase component 1 | 53% | 328.6 |
lactose catabolism | aglK' | lo | Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) | 33% | 96% | 175.3 | ABC transporter for Glycerol, ATPase component 1 | 53% | 328.6 |
D-maltose catabolism | aglK' | lo | Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) | 33% | 96% | 175.3 | ABC transporter for Glycerol, ATPase component 1 | 53% | 328.6 |
sucrose catabolism | aglK' | lo | Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) | 33% | 96% | 175.3 | ABC transporter for Glycerol, ATPase component 1 | 53% | 328.6 |
trehalose catabolism | aglK' | lo | Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) | 33% | 96% | 175.3 | ABC transporter for Glycerol, ATPase component 1 | 53% | 328.6 |
putrescine catabolism | potA | lo | Spermidine/putrescine import ATP-binding protein PotA, component of The spermidine/putrescine uptake porter, PotABCD (characterized) | 33% | 84% | 174.5 | ABC transporter for Glycerol, ATPase component 1 | 53% | 328.6 |
glycerol catabolism | glpT | lo | ABC transporter for Glycerol, ATPase component 2 (characterized) | 32% | 83% | 147.1 | ABC transporter for Glycerol, ATPase component 1 | 53% | 328.6 |
Sequence Analysis Tools
View WP_018125625.1 at NCBI
Find papers: PaperBLAST
Find functional residues: SitesBLAST
Search for conserved domains
Find the best match in UniProt
Compare to protein structures
Predict transmenbrane helices: Phobius
Predict protein localization: PSORTb
Find homologs in fast.genomics
Fitness BLAST: loading...
Sequence
MGLVLKDVDKYVGQEIHLKDINLELEPGKRYVLLGRTLAGKTSLLRIMAGLDRPSNGSVI
MNDVDVTGMSVRKRSVAMVYQQFINYPSLSVFKNIASPLKIAGTSRAEIKRRVQEAAKML
HIEHLLDRLPSELSGGQQQRCAIARALVKRVELLLLDEPLVNLDYKLREELREELQQIFE
RRESIVVYTTTEPTEALMLGGETIVMHEGRVLQTGPTAEVYLNPATTKVAEVFSDPPINF
VPAVIEDGNVRIGKGQVIPQQGRLADLEPGEYRFGMRSNRLFLKGQEGRTVRFDGTVGLS
EINGSETFVHMTYEDVPLVAQEVGVHQYGVGDEVSVFLDPNDFYVFGESGNLLVSPVRAD
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Links
Downloads
Related tools
About GapMind
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using
ublast (a fast alternative to protein BLAST)
against a database of manually-curated proteins (most of which are experimentally characterized) or by using
HMMer with enzyme models (usually from
TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
- ublast finds a hit to a characterized protein at above 40% identity and 80% coverage, and bits >= other bits+10.
- (Hits to curated proteins without experimental data as to their function are never considered high confidence.)
- HMMer finds a hit with 80% coverage of the model, and either other identity < 40 or other coverage < 0.75.
where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").
Otherwise, a candidate is "medium confidence" if either:
- ublast finds a hit at above 40% identity and 70% coverage (ignoring otherBits).
- ublast finds a hit at above 30% identity and 80% coverage, and bits >= other bits.
- HMMer finds a hit (regardless of coverage or other bits).
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps."
For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways.
For diverse bacteria and archaea that can utilize a carbon source, there is a complete
high-confidence catabolic pathway (including a transporter) just 38% of the time, and
there is a complete medium-confidence pathway 63% of the time.
Gaps may be due to:
- our ignorance of proteins' functions,
- omissions in the gene models,
- frame-shift errors in the genome sequence, or
- the organism lacks the pathway.
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory