Align ABC transporter for Xylitol, ATPase component (characterized)
to candidate WP_018123488.1 B149_RS0102020 ABC transporter ATP-binding protein
Query= reanno::Dino:3607124 (338 letters) >NCBI__GCF_000375485.1:WP_018123488.1 Length = 311 Score = 167 bits (422), Expect = 4e-46 Identities = 110/327 (33%), Positives = 160/327 (48%), Gaps = 35/327 (10%) Query: 6 IDKINKFYGTTQALFDINLDIEDGEFVVFVGPSGCGKSTLLRTLAGLEGVSSGRIEIGGR 65 ++ + K Y L D+ +E GE V +GPSG GK+TLL+ +AGL+ +SGR+ Sbjct: 5 VEGLTKTYEAAPVLEDVTFGMEKGEMVSIIGPSGAGKTTLLKLVAGLDRPTSGRV----- 59 Query: 66 DVTTVEPA-DRDLAMVFQSYALYPHMTVRENMEFGMKVNGFEPDLRKERIAEAARVLQLE 124 + EP+ + + MVFQ Y L+P MTV EN+ FG++ D + R+ E L Sbjct: 60 -IFQNEPSRENPVIMVFQDYVLFPSMTVCENVAFGLRARRLSGDEVRRRVMEVLDYFGLV 118 Query: 125 DYLDRKPGQLSGGQRQRVAIGRAIVKNPSVFLFDEPLSNLDAKLRVQMRVELEGLHKQLG 184 D P LSGGQRQRVAI R +V NP + L DEP +NLD L++Q + + G Sbjct: 119 SKADAYPEHLSGGQRQRVAIARGLVVNPMMLLLDEPFANLDRNLKLQTAEFIRETQRNFG 178 Query: 185 ATMIYVTHDQVEAMTMADKIVVLNRGRIEQVGSPMDLYHKPNSRFVAEFIGSPAMNVFSS 244 T + VTHD EA M+D+I ++ GR+ Q G D+Y P A F+G +NV Sbjct: 179 VTTLSVTHDLEEAFVMSDRIGLVMDGRLVQFGEARDVYFNPVHEDAARFLG--PLNVLEG 236 Query: 245 DVGLQDISLDASAAFVGC--------RPEHIEIVP--DGDGHIAATVHVKERLGGESLLY 294 +V +GC RPE + + P DG G + G Y Sbjct: 237 EV----------LTLMGCEGTQRRAVRPESLLLHPREDGAGRVLCA-----DFAGHFTKY 281 Query: 295 LGLKGGGQIVARVGGDDETKVGAAVSL 321 L ++ G ++ G D + G V++ Sbjct: 282 L-VEVGDTVITVYGTDSALRHGDRVAI 307 Lambda K H 0.320 0.139 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 282 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 338 Length of database: 311 Length adjustment: 28 Effective length of query: 310 Effective length of database: 283 Effective search space: 87730 Effective search space used: 87730 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory