Align ABC transporter for Xylitol, ATPase component (characterized)
to candidate WP_018125128.1 B149_RS0110385 spermidine/putrescine ABC transporter ATP-binding protein PotA
Query= reanno::Dino:3607124 (338 letters) >NCBI__GCF_000375485.1:WP_018125128.1 Length = 371 Score = 231 bits (589), Expect = 2e-65 Identities = 113/236 (47%), Positives = 161/236 (68%) Query: 4 IKIDKINKFYGTTQALFDINLDIEDGEFVVFVGPSGCGKSTLLRTLAGLEGVSSGRIEIG 63 I++D + K + T L ++LDI DGEF+ +GPSGCGK+T+LR LAG E G I +G Sbjct: 8 IRLDNLVKRFDDTTVLDRVSLDIRDGEFLTILGPSGCGKTTILRLLAGFETPDEGSIHLG 67 Query: 64 GRDVTTVEPADRDLAMVFQSYALYPHMTVRENMEFGMKVNGFEPDLRKERIAEAARVLQL 123 G + R + VFQSYAL+PHM+VR+N+ FG+K++G ER+ EA ++ L Sbjct: 68 GERINDKPANSRRVNTVFQSYALFPHMSVRDNLAFGLKMHGVSAREIDERVNEALDLVDL 127 Query: 124 EDYLDRKPGQLSGGQRQRVAIGRAIVKNPSVFLFDEPLSNLDAKLRVQMRVELEGLHKQL 183 +RKP LSGGQ+QRVAI RA+V P L DEPLS LDAKLR +M+V L+ + ++L Sbjct: 128 AYLANRKPDSLSGGQQQRVAIARAVVNKPLALLLDEPLSALDAKLRKRMQVRLKRMCREL 187 Query: 184 GATMIYVTHDQVEAMTMADKIVVLNRGRIEQVGSPMDLYHKPNSRFVAEFIGSPAM 239 G T ++VTHDQ EA M+D++VV+N GRIEQ+G+P ++Y +P + +VA F+G ++ Sbjct: 188 GMTFVFVTHDQEEAFAMSDRVVVMNEGRIEQIGTPEEVYEEPVNLYVARFVGETSI 243 Lambda K H 0.320 0.139 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 327 Number of extensions: 11 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 338 Length of database: 371 Length adjustment: 29 Effective length of query: 309 Effective length of database: 342 Effective search space: 105678 Effective search space used: 105678 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory