Align D-lactate oxidase and glycolate oxidase, FAD binding subunit (EC 1.1.3.15) (characterized)
to candidate WP_018232404.1 THITHI_RS0107195 FAD-linked oxidase C-terminal domain-containing protein
Query= reanno::psRCH2:GFF3771 (353 letters) >NCBI__GCF_000378965.1:WP_018232404.1 Length = 462 Score = 85.5 bits (210), Expect = 3e-21 Identities = 63/192 (32%), Positives = 94/192 (48%), Gaps = 3/192 (1%) Query: 27 RIQGSGSKSFLGLQADGVLLDTREHRGIVSYDPTELVVTVRAGTPLTELETALDEAGQML 86 R +G+G+ + GV+L I+ DP ++ V+ G ++ A E G Sbjct: 70 RGRGTGTTGATVPVSGGVVLSFERMGRILEVDPDNRLMVVQPGVTNQAVQDAAREHGFFW 129 Query: 87 PCEPPHFGEGATVGGMIAAGLSGPRRPWSGSVRDFVLGSRVITGQGKHLRFGGEVMKNVA 146 P +P TVGG +A +GPR G+ R+ LG ITG G+ LR G K V Sbjct: 130 PPDPTSAAV-CTVGGNLAYNSAGPRAVKYGTPRENTLGLCAITGDGRPLRTGVFTTKGVV 188 Query: 147 GYDLSRLMAGSFGCLGVLTEVSLKVLPKPRLCTSLR-LEIDLERALLKLAEWGQQP-IPI 204 GYDL+RL+ GS G L ++TE +LK+ P P +L+ + D+ A +A QP IP Sbjct: 189 GYDLTRLIIGSEGTLAIITEATLKLTPLPESTLTLQAVYADMRDAARAVAALMAQPVIPC 248 Query: 205 SAASHDGQALHL 216 + D A+ + Sbjct: 249 ALEFMDRSAIEM 260 Score = 26.6 bits (57), Expect = 0.001 Identities = 9/21 (42%), Positives = 15/21 (71%) Query: 332 RQLKAALDPQGIFNPGRMYSE 352 R++K+ DP GI NPG+ + + Sbjct: 440 RRIKSQFDPAGILNPGKGFPD 460 Lambda K H 0.319 0.137 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 442 Number of extensions: 24 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 353 Length of database: 462 Length adjustment: 31 Effective length of query: 322 Effective length of database: 431 Effective search space: 138782 Effective search space used: 138782 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory