Align Glucosamine-6-phosphate deaminase [isomerizing], alternative (EC 3.5.99.6) (characterized)
to candidate WP_018233136.1 THITHI_RS0110950 glutamine--fructose-6-phosphate transaminase (isomerizing)
Query= reanno::Korea:Ga0059261_1644 (347 letters) >NCBI__GCF_000378965.1:WP_018233136.1 Length = 608 Score = 127 bits (320), Expect = 6e-34 Identities = 99/317 (31%), Positives = 151/317 (47%), Gaps = 21/317 (6%) Query: 43 LRASPPAVVVTCARGSSDHAATYAKYLIETLTGVPTASAALSVASLYDAPVAPGNGLCLA 102 L A+ ++ C G+S HA A+Y +E + GVP S ++ Y V P L L Sbjct: 291 LDAAKGVHIIAC--GTSFHAGLVARYWLEEI-GVP-CSVEVASEFRYRKVVVPPETLFLT 346 Query: 103 ISQSGKSPDLLATVEHQRKAGAF-VVAMVNAEDSPLAALADIVIPLKAGPERSVAATKSY 161 ISQSG++ D LA + +K G + + N +S L +++ + +AGPE VA+TK++ Sbjct: 347 ISQSGETADTLAALRASKKMGYLGSLCVCNVPESSLVRESEVAVMTRAGPEIGVASTKAF 406 Query: 162 ICSLAAIAALVAAWAQ--------DEALETAVADLPAQLERAFALDW--SAAVTALTGAS 211 L A+ + A A+ ++AL + LP Q+E A +L A + Sbjct: 407 TTQLVALRLITLALARRTGMDRAREQALVEELESLPRQVEVALSLSEPIEQMANAFAEKT 466 Query: 212 GLFVLGRGYGYGIAQEAALKFKETCALHAESFSAAEVRHGPMAIVGEAFHVLAFASSDRA 271 LGRG Y +A E ALK KE +HAE++ A E++HGP+A+V V+ D Sbjct: 467 HALFLGRGSFYPVAMEGALKLKEISYIHAEAYPAGELKHGPLALVDADMPVICALPDDPL 526 Query: 272 GESVRETVAEFRSRGAEV-LLADPAAR-----QAGLPAIAAHPAIEPILIVQSFYKMANA 325 E V + E R+RG E+ L +D R L P+ PI+ +A Sbjct: 527 LEKVLSNLQEVRARGGELFLFSDQRIRIDLDHYHSLTLADICPSTAPIVYTVPLQLLAYH 586 Query: 326 LALARGCDPDSPPHLNK 342 A+ +G D D P +L K Sbjct: 587 TAVLKGTDVDQPRNLAK 603 Lambda K H 0.317 0.128 0.360 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 423 Number of extensions: 20 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 347 Length of database: 608 Length adjustment: 33 Effective length of query: 314 Effective length of database: 575 Effective search space: 180550 Effective search space used: 180550 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory