Align NatA aka BRAF aka SLR0467, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized)
to candidate WP_019557436.1 F612_RS0108985 ABC transporter ATP-binding protein
Query= TCDB::Q55164 (267 letters) >NCBI__GCF_000381085.1:WP_019557436.1 Length = 326 Score = 107 bits (267), Expect = 3e-28 Identities = 74/233 (31%), Positives = 109/233 (46%), Gaps = 24/233 (10%) Query: 24 LSKSFGGLRAVDHADIVVKEGSITGLIGPNGAGKTTLFNLLSNFIRPDQGEVLFNGDSIG 83 LS+SFG L+AVDH ++ + + SI G +GPNG+GK+T +L + P G+V G I Sbjct: 12 LSRSFGSLQAVDHLNLSIPKQSIYGFLGPNGSGKSTTMRMLCGLLTPSSGQVEVLGLEIP 71 Query: 84 QLA---PHQIALRGSVRTFQVAKVLSRLTVLENMLLADQHQTGEKFLPRLINFRRVQKEE 140 + A HQI Q + LTV EN+ F+ + N Sbjct: 72 RQAEQLKHQIGYMA-----QKFALYDDLTVAENL----------SFMAKAYNL-----PG 111 Query: 141 RANREKAMAMLESVGLGAKAQDYAGALSGGQRKLLEMARALMSNPKLILLDEPAAGVNPT 200 + ++ L L + G LSGGQ++ L +A A + PKL+ LDEP +GV+P Sbjct: 112 KTQAQRIAETLSRYALQPLQKQMTGTLSGGQKQRLSLAAATLHKPKLLFLDEPTSGVDPQ 171 Query: 201 LIGQICEHIVNWNRQGITFLVIEHNMDVIMTLCHHVWVLAEGRNLADGTPEQI 253 E + G+T LV H MD CH + +L G +AD +P + Sbjct: 172 SRRNFWESLFELVNDGVTILVSTHYMDE-AERCHGLAILDHGVKVADESPANL 223 Lambda K H 0.319 0.136 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 172 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 326 Length adjustment: 26 Effective length of query: 241 Effective length of database: 300 Effective search space: 72300 Effective search space used: 72300 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory