Align palmitoyl-CoA hydrolase (EC 3.1.2.2) (characterized)
to candidate WP_019557842.1 F612_RS0111085 S-formylglutathione hydrolase
Query= BRENDA::P33018 (278 letters) >NCBI__GCF_000381085.1:WP_019557842.1 Length = 278 Score = 296 bits (757), Expect = 4e-85 Identities = 149/279 (53%), Positives = 194/279 (69%), Gaps = 5/279 (1%) Query: 1 MEMLEEHRCFEGWQQRWRHDSSTLNCPMTFSIFLPPPRDHTPPPVLYWLSGLTCNDENFT 60 M+++E + F G+ R+ HDS+ C MTFS++LPP P LYWLSGLTC D+N Sbjct: 1 MKLIESIKEFGGFLNRYTHDSAVCQCEMTFSVYLPPQAAIQSVPALYWLSGLTCTDDNVR 60 Query: 61 TKAGAQRVAAELGIVLVMPDTSPRGEKVANDDG-YDLGQGAGFYLNATQPPWATHYRMYD 119 TKAGAQR AAE G+ +MPDTSPRGE V ++ YDLG+GAGFY+NATQ PW HY+MYD Sbjct: 61 TKAGAQRYAAEFGLAFIMPDTSPRGENVPDEPARYDLGKGAGFYVNATQAPWNEHYQMYD 120 Query: 120 YLRDELPALVQSQFN-VSDRCAISGHSMGGHGALIMALKNPGKYTSVSAFAPIVNPCSVP 178 Y+ ELP L+++ ++ + +ISGHSMGGHGALI ALKNPG Y SVSAF+PI +P Sbjct: 121 YVTRELPELLEANLPLIAGKKSISGHSMGGHGALICALKNPGAYQSVSAFSPICHPIECA 180 Query: 179 WGIKAFSSYLGEDKNAWLEWDSCALMYASNAQDAIPTLIDQGDNDQFL-ADQLQPAVLAE 237 WG F++YLGE++ +W +D+ AL+ A + I LIDQG +D+FL A QL P L Sbjct: 181 WGQGCFTAYLGENQKSWQAYDAVALIEAGASLADI--LIDQGTDDEFLTAGQLLPEALET 238 Query: 238 AARQKAWPMTLRIQPGYDHSYYFIASFIEDHLRFHAQYL 276 A + P+ LR Q GYDHSY+FIASFI +H+ +HA+ L Sbjct: 239 ACQNARIPLQLRRQAGYDHSYHFIASFIGEHMAYHAKAL 277 Lambda K H 0.320 0.136 0.441 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 287 Number of extensions: 15 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 278 Length of database: 278 Length adjustment: 25 Effective length of query: 253 Effective length of database: 253 Effective search space: 64009 Effective search space used: 64009 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory