GapMind for catabolism of small carbon sources

 

Protein WP_019866661.1 in Methylovulum miyakonense HT12

Annotation: NCBI__GCF_000384075.1:WP_019866661.1

Length: 584 amino acids

Source: GCF_000384075.1 in NCBI

Candidate for 23 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
L-histidine catabolism Ac3H11_2560 lo ABC transporter for L-Histidine, ATPase component (characterized) 38% 97% 183 ABC transporter for nitrate, ATPase component 63% 693.7
N-acetyl-D-glucosamine catabolism SMc02869 lo N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 40% 59% 143.7 ABC transporter for nitrate, ATPase component 63% 693.7
D-glucosamine (chitosamine) catabolism SMc02869 lo N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 40% 59% 143.7 ABC transporter for nitrate, ATPase component 63% 693.7
trehalose catabolism treV lo TreV, component of Trehalose porter (characterized) 32% 87% 143.3 ABC transporter for nitrate, ATPase component 63% 693.7
D-cellobiose catabolism gtsD lo GtsD (GLcK), component of Glucose porter, GtsABCD (characterized) 38% 57% 139.8 ABC transporter for nitrate, ATPase component 63% 693.7
D-glucose catabolism gtsD lo GtsD (GLcK), component of Glucose porter, GtsABCD (characterized) 38% 57% 139.8 ABC transporter for nitrate, ATPase component 63% 693.7
lactose catabolism gtsD lo GtsD (GLcK), component of Glucose porter, GtsABCD (characterized) 38% 57% 139.8 ABC transporter for nitrate, ATPase component 63% 693.7
D-maltose catabolism gtsD lo GtsD (GLcK), component of Glucose porter, GtsABCD (characterized) 38% 57% 139.8 ABC transporter for nitrate, ATPase component 63% 693.7
sucrose catabolism gtsD lo GtsD (GLcK), component of Glucose porter, GtsABCD (characterized) 38% 57% 139.8 ABC transporter for nitrate, ATPase component 63% 693.7
trehalose catabolism gtsD lo GtsD (GLcK), component of Glucose porter, GtsABCD (characterized) 38% 57% 139.8 ABC transporter for nitrate, ATPase component 63% 693.7
D-xylose catabolism gtsD lo ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 37% 56% 138.3 ABC transporter for nitrate, ATPase component 63% 693.7
D-maltose catabolism thuK lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 38% 55% 136.7 ABC transporter for nitrate, ATPase component 63% 693.7
D-mannose catabolism TT_C0211 lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 38% 55% 136.7 ABC transporter for nitrate, ATPase component 63% 693.7
sucrose catabolism thuK lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 38% 55% 136.7 ABC transporter for nitrate, ATPase component 63% 693.7
trehalose catabolism thuK lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 38% 55% 136.7 ABC transporter for nitrate, ATPase component 63% 693.7
putrescine catabolism potA lo spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 (characterized) 36% 62% 136.3 ABC transporter for nitrate, ATPase component 63% 693.7
D-maltose catabolism malK lo Maltose-transporting ATPase (EC 3.6.3.19) (characterized) 37% 56% 134.8 ABC transporter for nitrate, ATPase component 63% 693.7
D-maltose catabolism aglK lo ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 37% 59% 130.6 ABC transporter for nitrate, ATPase component 63% 693.7
D-maltose catabolism malK_Sm lo MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) 36% 58% 130.6 ABC transporter for nitrate, ATPase component 63% 693.7
sucrose catabolism aglK lo ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 37% 59% 130.6 ABC transporter for nitrate, ATPase component 63% 693.7
trehalose catabolism aglK lo ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 37% 59% 130.6 ABC transporter for nitrate, ATPase component 63% 693.7
trehalose catabolism malK lo MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) 36% 58% 130.6 ABC transporter for nitrate, ATPase component 63% 693.7
L-arabinose catabolism xacK lo Xylose/arabinose import ATP-binding protein XacK; EC 7.5.2.13 (characterized, see rationale) 34% 57% 130.2 ABC transporter for nitrate, ATPase component 63% 693.7

Sequence Analysis Tools

View WP_019866661.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MTAATKLKLVHPAMTEQPKSPSNDPELPLVELVNVCKSYGEGKNKASILKNINLSIKDGE
FIAIVGFSGSGKTTLISTLAGLIQADSGAVLKQGKPITAPGPDRGVVFQNYSLMPWLTVF
ENVALAVDEIFKDWPADKRRAHTEKYVRMVNLGAAMDKMPAELSGGMRQRVNVARALAAN
PDILLLDEPLSALDALTRGNLQDEILSIWEQEKKTVILITNDVDEAIYMADRVIPLNPGP
DATFGPDFPVTIARPRDRTALNHNEEFKRLRAEITQYLMAIGMEKAQDTLGDKVILPNVR
PNTSNDWKNDSSALKPEQDNLGKARYLEFSQLSKIYPKPSGNGTVKVVDGFDLKMKKGEF
ISIIGHSGCGKSTVLSMAAGLTSISEGGIILDNREVDSAGPDKGVVFQAPSLFPWLTAFE
NVMLGVDKVYPHAKKSEREDIVEYYLTRVGLGDALRKKAGDMSNGMRQRVGIARAFALSP
KLLLLDEPFGMLDSLTRWELQEVLMEVWERTHVTAIVVTHDVDEAILLADRVVMMTNGPH
AKIGKIQEIDLPRPRSRKALLAHDDYYRYRESILTFLTECDHTH

This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory