Align 3-oxoadipyl-CoA/3-oxo-5,6-dehydrosuberyl-CoA thiolase; EC 2.3.1.174; EC 2.3.1.223 (characterized)
to candidate WP_022671372.1 G415_RS0109095 thiolase family protein
Query= SwissProt::P0C7L2 (401 letters) >NCBI__GCF_000420385.1:WP_022671372.1 Length = 389 Score = 272 bits (696), Expect = 1e-77 Identities = 155/401 (38%), Positives = 240/401 (59%), Gaps = 12/401 (2%) Query: 1 MREAFICDGIRTPIGRYGGALSSVRADDLAAIPLRELLVRNPRLDAECIDDVILGCANQA 60 M F+ + +R+P G +GG LSS+ A ++A+ ++E+L R E +D +I+G A Sbjct: 1 MDGVFVVEPLRSPFGGFGGTLSSLSASEIASFVVKEILSRT---GIEDVDGLIMGNVLSA 57 Query: 61 GEDNRNVARMATLLAGLPQSVSGTTINRLCGSGLDALGFAARAIKAGDGDLLIAGGVESM 120 G ++ AR + +GLP SV+ T+N++CGSGL +L AA++IK D L+IAGG+ESM Sbjct: 58 GV-GQSPARQVIIKSGLPYSVNALTVNKVCGSGLKSLMLAAQSIKLKDSSLIIAGGMESM 116 Query: 121 SRAPFVMGKAASAFSRQAEMFDTTIGWRFVNPLMAQQFGTDSMPETAENVAELLKISRED 180 S AP+ + KA + M D + + + M AE VA+ KI+R+ Sbjct: 117 SNAPYYLSKARFGY----RMGDGRAIDGMIFDGLWDVYNNVHMGYLAEMVAKAKKITRKI 172 Query: 181 QDSFALRSQQRTAKAQSSGILAEEIVPVVLKNKKGVVTEIQHDEHLRPETTLEQLRGLKA 240 QD +A+ S +R + +G+ EEIVP+ + ++KGV + +E R + E++ LK Sbjct: 173 QDDYAVLSYKRAQHSAENGVFKEEIVPIEISSRKGVNVVDRDEEPFRVD--FEKIPKLKP 230 Query: 241 PFRANGVITAGNASGVNDGAAALIIASEQMAAAQGLTPRARIVAMATAGVEPRLMGLGPV 300 F +G ITA NAS ++DGAAA I+A GL P A++VA + ++P+L L P+ Sbjct: 231 AFVEDGTITAANASTISDGAAAFIVADYDAIKRFGLEPIAKVVAYSEFSLDPKLFPLAPI 290 Query: 301 PATRRVLERAGLSIHDMDVIELNEAFAAQALGVLRELGLPDDAPHVNPNGGAIALGHPLG 360 A ++L++ GL ++D+D+ E+NEAF+ L L EL L D VN NGGA++LGHPLG Sbjct: 291 GAIEKLLKKTGLDVNDIDLFEINEAFSCVVLAALEELKL--DIDRVNVNGGAVSLGHPLG 348 Query: 361 MSGARLALAASHELHRRNGRYALCTMCIGVGQGIAMILERV 401 SGARL ++ + E+ RRN +Y + +CIG G+ +A + ERV Sbjct: 349 ASGARLVVSLTREMRRRNAKYGIAALCIGGGEAVATLFERV 389 Lambda K H 0.319 0.135 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 350 Number of extensions: 19 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 401 Length of database: 389 Length adjustment: 31 Effective length of query: 370 Effective length of database: 358 Effective search space: 132460 Effective search space used: 132460 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory