Align Leucine/isoleucine/valine ABC transporter,permease component (characterized, see rationale)
to candidate WP_022671208.1 G415_RS0108255 branched-chain amino acid ABC transporter permease
Query= uniprot:G8ALI9 (505 letters) >NCBI__GCF_000420385.1:WP_022671208.1 Length = 315 Score = 176 bits (446), Expect = 1e-48 Identities = 105/316 (33%), Positives = 170/316 (53%), Gaps = 30/316 (9%) Query: 154 IAVVVALAFPFTPLADRQLLDIGILLLTYIMLGWGLNIVVGLAGLLDLGYVAFYAVGAYS 213 I +++ A PF + + + L Y + +IV+G AG+ D+G+ F+ +GAY+ Sbjct: 11 IFLLILAALPFG--LNSNWVSVMTTFLIYSTVALSQDIVLGRAGMFDMGHAIFFGLGAYA 68 Query: 214 YALLAHYFGFSFWVCLPLAGFLAAMSGVLLGFPVLRLRGDYFAIVTLGFGEII-RIILIN 272 A+L FG+ +P+A L ++ VLL P++ LRGDY + T+GF + + + N Sbjct: 69 TAILNMQFGWPILATIPIAIILPTIASVLLAAPIIHLRGDYLLVTTIGFNIVFTQALKNN 128 Query: 273 WYQFTGGPNGISGIPRPSFFGIADFTRTPAEGTAAFHEMFGLEFSPLHRIIFLYYLILVL 332 + TGGPNGI FG+ ++FG F+ + + FL IL+L Sbjct: 129 VFGVTGGPNGI--------FGVEPL------------KIFGFTFASQNSVYFLALFILIL 168 Query: 333 ALVV--NLFTMRVRKLPLGRAWEALREDDIACASLGINRTNMKLAAFAIAAMFGGFAGSF 390 L++ NL T + GRA L D +A +GIN +L +FA++A G AG Sbjct: 169 TLIIIHNLETSKP-----GRALHYLNLDSLASECIGINTKFYRLYSFALSAAIAGLAGVV 223 Query: 391 FATRQGFISPESFTFIESAIILAIVVLGGMGSQIGVVVAAFLVIGLPEAFRELADYRMLA 450 F + +SP++F FI+S + IV++GG S GV++ F + +PE FR+ A+ R L Sbjct: 224 FTLQFSAVSPDAFNFIQSVLFFTIVLVGGPSSIPGVLLGTFFMFVVPEIFRQFAEARYLV 283 Query: 451 FGMGMVLIMLWRPRGL 466 FG+ M+LIM++RP+G+ Sbjct: 284 FGIAMILIMIFRPKGI 299 Lambda K H 0.329 0.144 0.438 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 371 Number of extensions: 24 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 505 Length of database: 315 Length adjustment: 31 Effective length of query: 474 Effective length of database: 284 Effective search space: 134616 Effective search space used: 134616 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory