Align ABC transporter for D-Alanine, permease component 1 (characterized)
to candidate WP_022669622.1 G415_RS0100535 amino acid ABC transporter permease
Query= reanno::pseudo6_N2E2:Pf6N2E2_5404 (365 letters) >NCBI__GCF_000420385.1:WP_022669622.1 Length = 313 Score = 123 bits (309), Expect = 6e-33 Identities = 67/203 (33%), Positives = 117/203 (57%), Gaps = 7/203 (3%) Query: 157 GLMLTLVIATVGIVGALPLGIVLALGRRSNMPAIRVVCVTFIEFWRGVPLITVLFMSSVM 216 GL +T+ ++ V I+ AL +G + L R S P R + V +IE RG PL+ +F+ Sbjct: 114 GLYMTIKVSVVSIIMALIIGFIAGLMRISENPLFRNLSVVYIEIIRGTPLLVQIFI---- 169 Query: 217 LPLFLPEGMNFDKLLRALIGVILFQSAYIAEVVRGGLQAIPKGQYEAAAAMGLGYWRSMG 276 + F+ N + + +F+ AYIAE++R G+Q+IP+GQ EA+ A+G+ Y++ M Sbjct: 170 VYFFVGTIFNMTRFFAGAFALAVFEGAYIAEIIRAGIQSIPRGQTEASLALGMNYFQIMR 229 Query: 277 LVILPQALKLVIPGIVNTFIALFKDTSLVIIIGLFDLLNSVKQAAADPKWLGMATEGYVF 336 +I+PQA+K V+P + FI+L KD+SL+ +I L +L + ++ + E + Sbjct: 230 YIIMPQAIKRVLPALAGQFISLIKDSSLLSVISLTELTKAGREIVSS---TFSPFEIWFS 286 Query: 337 AALVFWIFCFGMSRYSMHLERKL 359 A +++I + +S +LER+L Sbjct: 287 VAALYFIVTYSLSLLDRYLERRL 309 Lambda K H 0.330 0.144 0.469 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 261 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 365 Length of database: 313 Length adjustment: 28 Effective length of query: 337 Effective length of database: 285 Effective search space: 96045 Effective search space used: 96045 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory