Align Arginine transport ATP-binding protein ArtM (characterized)
to candidate WP_022669623.1 G415_RS0100540 amino acid ABC transporter ATP-binding protein
Query= SwissProt::P54537 (240 letters) >NCBI__GCF_000420385.1:WP_022669623.1 Length = 245 Score = 270 bits (689), Expect = 3e-77 Identities = 135/241 (56%), Positives = 178/241 (73%), Gaps = 1/241 (0%) Query: 1 MIKVEKLSKSFGKH-EVLKNISTTIAEGEVVAVIGPSGSGKSTFLRCLNLLEKPNGGTIT 59 +I E L K+F + L+++S T+ +GEVV +IG SGSGK+TFLR +N LE + G I Sbjct: 5 IIIAEHLHKTFPNGVQALRDVSLTVKKGEVVVIIGASGSGKTTFLRTINQLETVDSGRII 64 Query: 60 IKDTEITKPKTNTLKVRENIGMVFQHFHLFPHKTVLENIMYAPVNVKKESKQAAQEKAED 119 + ++T PKTN K+R +IGMVFQHF++FPH TVLEN+ + V+K K+ A++ A + Sbjct: 65 VDGVDLTDPKTNLTKIRADIGMVFQHFNVFPHLTVLENVTIGQILVRKRPKEEAKKIALE 124 Query: 120 LLRKVGLFEKRNDYPNRLSGGQKQRVAIARALAMNPDIMLFDEPTSALDPEMVKEVLQVM 179 L KVG+ +K+++YP LSGGQKQRVAIARALAMNP IMLFDE TSALDPEMV +L +M Sbjct: 125 FLTKVGIADKKDEYPTNLSGGQKQRVAIARALAMNPKIMLFDEATSALDPEMVGGILDIM 184 Query: 180 KELVETGMTMVIVTHEMGFAKEVADRVLFMDQGMIVEDGNPKEFFMSPKSKRAQDFLEKI 239 K L + G+TMV+VTHEMGFA+E ADR+++MD G IVE G P E F +PKS R + FL +I Sbjct: 185 KALAKEGITMVVVTHEMGFAREAADRIVYMDSGKIVEMGTPDEIFSNPKSDRLKQFLSQI 244 Query: 240 L 240 L Sbjct: 245 L 245 Lambda K H 0.317 0.134 0.368 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 184 Number of extensions: 4 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 240 Length of database: 245 Length adjustment: 23 Effective length of query: 217 Effective length of database: 222 Effective search space: 48174 Effective search space used: 48174 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory