Align histidine transport ATP-binding protein hisP (characterized)
to candidate WP_022670123.1 G415_RS0103075 ATP-binding cassette domain-containing protein
Query= CharProtDB::CH_003210 (257 letters) >NCBI__GCF_000420385.1:WP_022670123.1 Length = 252 Score = 139 bits (350), Expect = 6e-38 Identities = 81/235 (34%), Positives = 136/235 (57%), Gaps = 12/235 (5%) Query: 6 LNVIDLHKRYGEHEVLKGVSLQANAGDVISIIGSSGSGKSTFLRCINFLEKPSEGSIVVN 65 + V DL ++G+ VLKG+ + + GD+ +I+G SGSGK+T LR I LEK S G+I V Sbjct: 4 IKVRDLRVKFGDRVVLKGIDITVDKGDIYAILGKSGSGKTTLLRSILMLEKFS-GTIEVF 62 Query: 66 GQTINLVRDKDGQLKVADKNQLRLLRTRLTMVFQHFNLWSHMTVLENVMEAPIQVLGLSK 125 G +N R+++ Q +R R ++FQ +L++ +TV EN++ + + + LSK Sbjct: 63 GVNLNRAREEEKQA----------IRNRYGVMFQAASLFTSLTVGENILASIRERVKLSK 112 Query: 126 QEARERAVKYLAKVGIDERAQGKYPVHLSGGQQQRVSIARALAMEPEVLLFDEPTSALDP 185 E L VG++ YP LSGG +++ ++ARALA++PE++ DEPTS LDP Sbjct: 113 NLLDEFVSFKLRLVGLESWVSNLYPYELSGGMRKKAALARALALDPEIIFLDEPTSGLDP 172 Query: 186 ELVGEVLRIMQQLAE-EGKTMVVVTHEMGFARHVSTHVIFLHQGKIEEEGAPEQL 239 + +++L E G T+V++TH++ +++ + +GK+ EG P + Sbjct: 173 VSADDFDNTIRKLNELLGITVVMITHDLDSLFNIAKRACVIREGKVLAEGKPSDI 227 Lambda K H 0.318 0.134 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 142 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 257 Length of database: 252 Length adjustment: 24 Effective length of query: 233 Effective length of database: 228 Effective search space: 53124 Effective search space used: 53124 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory