Align Arginine transport ATP-binding protein ArtM (characterized)
to candidate WP_022671297.1 G415_RS0108675 ABC transporter ATP-binding protein
Query= SwissProt::P54537 (240 letters) >NCBI__GCF_000420385.1:WP_022671297.1 Length = 248 Score = 153 bits (386), Expect = 3e-42 Identities = 86/240 (35%), Positives = 147/240 (61%), Gaps = 4/240 (1%) Query: 1 MIKVEKLSKSFGKHEVLKNISTTIAEGEVVAVIGPSGSGKSTFLRCLNLLEKPNGGTITI 60 MI+V+ LS +F +VL ++ I +G++ +IG SG+GKS L+ + L KPN G+I + Sbjct: 1 MIEVKDLSVNFYNQKVLDELNLNIEKGKITVIIGKSGAGKSVLLKNIIGLLKPNKGSIIV 60 Query: 61 KDTEITKPKTNTLK-VRENIGMVFQHFHLFPHKTVLENIMYAPVNVKK-ESKQAAQEKAE 118 + +ITK + + LK +R N G++FQ LF TV ENI + + K ++K+ ++K + Sbjct: 61 EGKDITKIRYDELKRIRLNFGVLFQEAALFDSLTVFENIAFPLIERKLIKNKKELKDKVK 120 Query: 119 DLLRKVGLFEKRNDYPNRLSGGQKQRVAIARALAMNPDIMLFDEPTSALDPEMVKEVLQV 178 + L V L + N P+ LSGG K+RV +ARA+ NP I+ FDEPT+ LDP + ++ Sbjct: 121 EALSLVELHDIENKLPSELSGGMKKRVGLARAIITNPKIIFFDEPTTGLDPITAMSIAKL 180 Query: 179 MKELVET-GMTMVIVTHEMGFAKEVADRVLFMDQGMIVEDGNPKEFFMSPKSKRAQDFLE 237 +K + +T T I++H++ ++ADR+ F+ +G I+E G+ ++ + + ++FLE Sbjct: 181 IKNMQQTLNTTCFIISHDLALTFKIADRIGFLHEGKIIEFGDAEQ-IKNSNNPIVKEFLE 239 Lambda K H 0.317 0.134 0.368 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 170 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 240 Length of database: 248 Length adjustment: 24 Effective length of query: 216 Effective length of database: 224 Effective search space: 48384 Effective search space used: 48384 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory