Align Gamma-glutamyl-putrescine synthetase (EC 6.3.1.11) (characterized)
to candidate WP_022670511.1 G415_RS0104980 type I glutamate--ammonia ligase
Query= reanno::BFirm:BPHYT_RS23160 (444 letters) >NCBI__GCF_000420385.1:WP_022670511.1 Length = 470 Score = 154 bits (389), Expect = 6e-42 Identities = 122/364 (33%), Positives = 173/364 (47%), Gaps = 39/364 (10%) Query: 67 VTDPDMVCVPDASTIRMIPWAVDPTAQVIHDCVH-FDGTPVAISPRRVLRRVLELYKAKG 125 + + DM+ +PD +T M P+A T +I D V P PR + ++ E K+ G Sbjct: 61 INESDMLVMPDPATAFMDPFAEVATLNIICDIVDPITREPYERHPRAIAKKAEEFLKSSG 120 Query: 126 WKPV--IAPELEFYLVDMNKDPDLPLQPP-----------IGRTGRPETGRQAYSIEAVN 172 V PELEF+++D D ++P I +G+ E Y I+ Sbjct: 121 IADVAFFGPELEFFILD---DVRYDVKPNTSYYAVDSVEGIWNSGKDEDPNLGYKIKHKE 177 Query: 173 EFDP---------LFEDIYEYCEVQELEVDTLIHEVGAA-QMEINFMHGDPLKLADSVFL 222 + P L +I E +EV+ HEV A Q EI+ + L+ AD+V Sbjct: 178 GYFPVAPLDSLQDLRSEIVLELEKAGIEVEAHHHEVATAGQAEIDIKYASLLQQADNVMK 237 Query: 223 FKRTVREAALRHKMYATFMAKPMEGEPGSAMHMHQSLVDEETGHNLFTGPDGKPTS-LFT 281 +K + A + TFM KP+ G+ G+ MH HQSL + G LF G S + Sbjct: 238 YKYIAKNVAFMYGKTITFMPKPIAGDNGTGMHTHQSLWKD--GKPLFAGNGYAGLSEIGL 295 Query: 282 SYIAGLQKYTPALMPIFAPYINSYRRLSRFMAAPINVAWGYDNRTVGFRIPHSGPA--AR 339 YI G+ K+ AL P +NSY+RL APIN+A+ NR+ RIP P+ A+ Sbjct: 296 YYIGGILKHGKALAAFTNPTMNSYKRLVPGFEAPINLAYSSRNRSAAVRIPMYSPSPKAK 355 Query: 340 RIENRIPGVDCNPYLAIAATLAAGYLGMTQKLEATEPLLSDGYELP-------YQLPRNL 392 RIE R P NPYLA A L AG G+ K++ EPL + Y+LP ++PRNL Sbjct: 356 RIEVRFPDPSANPYLAFTAMLMAGIDGIINKIDPGEPLDKNIYDLPPEELAKVEKMPRNL 415 Query: 393 EEGL 396 EE L Sbjct: 416 EEAL 419 Lambda K H 0.321 0.138 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 563 Number of extensions: 38 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 444 Length of database: 470 Length adjustment: 33 Effective length of query: 411 Effective length of database: 437 Effective search space: 179607 Effective search space used: 179607 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory