Align ABC transporter for L-asparagine and L-glutamate, ATPase component (characterized)
to candidate WP_022670152.1 G415_RS0103225 phosphate ABC transporter ATP-binding protein PstB
Query= reanno::pseudo1_N1B4:Pf1N1B4_774 (244 letters) >NCBI__GCF_000420385.1:WP_022670152.1 Length = 251 Score = 133 bits (335), Expect = 3e-36 Identities = 83/233 (35%), Positives = 135/233 (57%), Gaps = 12/233 (5%) Query: 1 MISIKNVNKWYGDFQVLTDCSTEVKKGEVIVVCGPSGSGKSTLIKCVNALEPFQKG---- 56 ++S+KN+N +YG Q+L + + ++ K + + GPSG GK+T ++C N + KG Sbjct: 5 LLSVKNLNFFYGKTQILHNINMDIYKNRITALIGPSGCGKTTFLRCFNRMHDLYKGNRYE 64 Query: 57 -DVIVDGTSIADPKTNLPKLRSRVGMVFQHFELFPHLSIMDN----LTIAQVKVLGRSKE 111 +++ G +I K +L +LRS++GMVFQ FP +SI DN L + +K +E Sbjct: 65 GEILYKGENILKVK-DLIELRSKIGMVFQKPTPFP-MSIFDNVAYGLKLKGIKDKNIIRE 122 Query: 112 EASKKALQLLERVGLSAHAKKHPGQLSGGQQQRVAIARALAMDPIVMLFDEPTSALDPEM 171 K ++ + LSGGQQQR+ IARALA++P ++LFDEPTSALDP Sbjct: 123 RVEKALIEAALWDEVKDKLYSSALALSGGQQQRMVIARALAVEPDIILFDEPTSALDPIA 182 Query: 172 VNEVLDVMVQLAHEGMTMMCVTHEMGFARKVADRVIFMDQGKIIEDCKKEEFF 224 +++ +++ L + T++ VTH M A +V+D F+ +G +IE + E+ F Sbjct: 183 TSKIEELLFNL-KKITTILIVTHNMQQAARVSDFTAFLFKGHLIEFERTEKLF 234 Lambda K H 0.321 0.135 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 140 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 244 Length of database: 251 Length adjustment: 24 Effective length of query: 220 Effective length of database: 227 Effective search space: 49940 Effective search space used: 49940 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory