Align ATPase (characterized, see rationale)
to candidate WP_022670152.1 G415_RS0103225 phosphate ABC transporter ATP-binding protein PstB
Query= uniprot:Q31RN8 (261 letters) >NCBI__GCF_000420385.1:WP_022670152.1 Length = 251 Score = 117 bits (292), Expect = 3e-31 Identities = 77/251 (30%), Positives = 136/251 (54%), Gaps = 19/251 (7%) Query: 19 ETMIYAEGVEKWYGNQFQALCGVSLTVQRGEVVVMMGPSGSGKSTFLRTLNALE-----S 73 + ++ + + +YG Q L +++ + + + ++GPSG GK+TFLR N + + Sbjct: 3 QVLLSVKNLNFFYGKT-QILHNINMDIYKNRITALIGPSGCGKTTFLRCFNRMHDLYKGN 61 Query: 74 HQRGEIWIEGHRLSHDRRDIATIRQEVGMVFQQFNLFPHLTVLQN----LMLAPVQVRRW 129 GEI +G + + D+ +R ++GMVFQ+ FP +++ N L L ++ + Sbjct: 62 RYEGEILYKGENILKVK-DLIELRSKIGMVFQKPTPFP-MSIFDNVAYGLKLKGIKDKN- 118 Query: 130 PVAQAEATARQLLERVRIAEQADKYPGQ---LSGGQQQRVAIARALAMQPRILLFDEPTS 186 E + L+E E DK LSGGQQQR+ IARALA++P I+LFDEPTS Sbjct: 119 --IIRERVEKALIEAALWDEVKDKLYSSALALSGGQQQRMVIARALAVEPDIILFDEPTS 176 Query: 187 ALDPEMVREVLDVMRDLASEGMTMLVATHEVGFAREVADRVVLMADGQIVEEAPPDRFFT 246 ALDP ++ +++ +L + T+L+ TH + A V+D + G ++E ++ FT Sbjct: 177 ALDPIATSKIEELLFNL-KKITTILIVTHNMQQAARVSDFTAFLFKGHLIEFERTEKLFT 235 Query: 247 APQSDRAKQFL 257 P+ + ++++ Sbjct: 236 NPKEELTEKYI 246 Lambda K H 0.321 0.134 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 131 Number of extensions: 7 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 251 Length adjustment: 24 Effective length of query: 237 Effective length of database: 227 Effective search space: 53799 Effective search space used: 53799 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory